Germany
Japan
United Kingdom
China
PSMD6 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Psmd6 (Myc-DDK-tagged) - Mouse proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (Psmd6)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PSMD6 (GFP-tagged) - Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PSMD6 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN402292 is the updated version of KN202292.
Psmd6 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN514125 is the updated version of KN314125.
Psmd6 (GFP-tagged) - Mouse proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (Psmd6)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Psmd6 (Myc-DDK-tagged) - Mouse proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (Psmd6)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Psmd6 (Myc-DDK-tagged) - Mouse proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (Psmd6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Psmd6 (mGFP-tagged) - Mouse proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (Psmd6)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Psmd6 (GFP-tagged) - Mouse proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (Psmd6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PSMD6 (Myc-DDK tagged) - Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PSMD6 (mGFP-tagged) - Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PSMD6 (Myc-DDK tagged) - Homo sapiens proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PSMD6 (Myc-DDK tagged) - Homo sapiens proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PSMD6 (Myc-DDK tagged) - Homo sapiens proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PSMD6 (GFP-tagged) - Homo sapiens proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PSMD6 (GFP-tagged) - Homo sapiens proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PSMD6 (GFP-tagged) - Homo sapiens proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Psmd6 (Myc-DDK-tagged ORF) - Rat proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (Psmd6), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Psmd6 (Myc-DDK-tagged ORF) - Rat proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (Psmd6), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Psmd6 (Myc-DDK-tagged ORF) - Rat proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (Psmd6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Psmd6 (mGFP-tagged ORF) - Rat proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (Psmd6), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Psmd6 (GFP-tagged ORF) - Rat proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (Psmd6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Transient overexpression lysate of proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PSMD6 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Psmd6 (untagged) - Mouse proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (Psmd6), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PSMD6 (untagged)-Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal anti-PSMD6 antibody
| Applications | WB |
| Reactivities | Human Mouse Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PSMD6. |
Rabbit Polyclonal Anti-PSMD6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMD6 antibody: synthetic peptide directed towards the N terminal of human PSMD6. Synthetic peptide located within the following region: YEALCKSLDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDA |
Rabbit Polyclonal Anti-PSMD6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMD6 antibody: synthetic peptide directed towards the N terminal of human PSMD6. Synthetic peptide located within the following region: PLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNMA |
PSMD6 CRISPRa kit - CRISPR gene activation of human proteasome 26S subunit, non-ATPase 6
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Psmd6 CRISPRa kit - CRISPR gene activation of mouse proteasome (prosome, macropain) 26S subunit, non-ATPase, 6
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene PSMD6
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene PSMD6
qPCR primer pairs and template standards against Mus musculus gene Psmd6
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Psmd6
PSMD6 MS Standard C13 and N15-labeled recombinant protein (NP_055629)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Psmd6 (untagged ORF) - Rat proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (Psmd6), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of proteasome (prosome macropain) 26S subunit non-ATPase 6 (PSMD6) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
(untagged)-Human cDNA FLJ30648 fis, clone CTONG2006449, moderately similar to Drosophila melanogaster 26S proteasome regulatory complex subunit p42A mRNA
| Vector | pCMV6 series |
| Tag | Tag Free |
PSMD6 (untagged) - Homo sapiens proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
PSMD6 (untagged) - Homo sapiens proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), transcript variant 4
| Vector | pCMV6 series |
| Tag | Tag Free |
PSMD6 (untagged) - Homo sapiens proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), transcript variant 1
| Vector | pCMV6 series |
| Tag | Tag Free |
PSMD6 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Psmd6 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Psmd6 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Anti-PSMD6 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 371-384 amino acids of Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 |
Active filters
Target Symbol
- PSMD6