USD 98.00
USD 560.00
In Stock
ADSL (Myc-DDK-tagged)-Human adenylosuccinate lyase (ADSL), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 98.00
USD 560.00
In Stock
ADSL (Myc-DDK-tagged)-Human adenylosuccinate lyase (ADSL), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ADSL (Myc-DDK-tagged)-Human adenylosuccinate lyase (ADSL), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human adenylosuccinate lyase (ADSL), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
ADSL (GFP-tagged) - Human adenylosuccinate lyase (ADSL), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human adenylosuccinate lyase (ADSL), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, ADSL (Myc-DDK tagged) - Human adenylosuccinate lyase (ADSL), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human adenylosuccinate lyase (ADSL), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, ADSL (mGFP-tagged) - Human adenylosuccinate lyase (ADSL), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ADSL (Myc-DDK-tagged)-Human adenylosuccinate lyase (ADSL), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, ADSL (Myc-DDK-tagged)-Human adenylosuccinate lyase (ADSL), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ADSL (mGFP-tagged)-Human adenylosuccinate lyase (ADSL), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, ADSL (mGFP-tagged)-Human adenylosuccinate lyase (ADSL), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ADSL (GFP-tagged) - Human adenylosuccinate lyase (ADSL), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ADSL (untagged)-Human adenylosuccinate lyase (ADSL), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
ADSL (untagged)-Human adenylosuccinate lyase (ADSL), transcript variant 1
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
ADSL HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
USD 121.00
In Stock
ADSL HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
USD 396.00
In Stock
Transient overexpression lysate of adenylosuccinate lyase (ADSL), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-ADSL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ADSL antibody: synthetic peptide directed towards the middle region of human ADSL. Synthetic peptide located within the following region: RVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFI |
Adenylosuccinate lyase / ASL (1-484, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
Adenylosuccinate lyase / ASL (1-484, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) ADSL mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Transient overexpression lysate of adenylosuccinate lyase (ADSL), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
ADSL MS Standard C13 and N15-labeled recombinant protein (NP_000017)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
ADSL (untagged)-Human adenylosuccinate lyase (ADSL), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Anti-ADSL Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human adenylosuccinate lyase |
USD 379.00
In Stock
ADSL (Adenylosuccinate Lyase) mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ADSL (Adenylosuccinate Lyase) mouse monoclonal antibody, clone OTI2D10 (formerly 2D10), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
USD 420.00
4 Weeks
ADSL (Adenylosuccinate Lyase) mouse monoclonal antibody, clone OTI2D10 (formerly 2D10), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
USD 159.00
2 Days
ADSL (Adenylosuccinate Lyase) mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Transient overexpression of ADSL (NM_000026) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ADSL (NM_001123378) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ADSL (NM_000026) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ADSL (NM_000026) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ADSL (NM_001123378) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ADSL (NM_001123378) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack