Products

cDNA Clones (10)
Proteins (9)
Antibodies (4)
Jump to Filters
View as table Download
GMP Synthase (GMPS) (NM_003875) Human Tagged ORF Clone
RC204267L4

USD 810.00

3 Weeks

Lenti ORF clone of Human guanine monphosphate synthetase (GMPS), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GMP Synthase (GMPS) (NM_003875) Human Tagged ORF Clone
RG204267

USD 670.00

3 Weeks

GMPS (GFP-tagged) - Human guanine monphosphate synthetase (GMPS)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GMP Synthase (GMPS) (NM_003875) Human Untagged Clone
SC117688

USD 760.00

In Stock

GMPS (untagged)-Human guanine monphosphate synthetase (GMPS)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
GMP Synthase (GMPS) Rabbit Polyclonal Antibody
TA346719

USD 475.00

5 Days

Rabbit Polyclonal Anti-GMPS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GMPS antibody: synthetic peptide directed towards the middle region of human GMPS. Synthetic peptide located within the following region: VCTALLNRALNQEQVIAVHIDNGFMRKRESQSVEEALKKLGIQVKVINAA
GMP Synthase (GMPS) (NM_003875) Human Tagged ORF Clone
RC204267L2

USD 810.00

3 Weeks

Lenti ORF clone of Human guanine monphosphate synthetase (GMPS), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
GMP Synthase (GMPS) (Center) Rabbit Polyclonal Antibody
AP18037PU-N

USD 450.00

2 Weeks

GMP Synthase (GMPS) (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human GMPS
GMP Synthase (GMPS) (C-term) Rabbit Polyclonal Antibody
AP18038PU-N

USD 450.00

2 Weeks

GMP Synthase (GMPS) (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human GMPS
GMP Synthase (GMPS) (NM_003875) Human Over-expression Lysate
LY418378

USD 396.00

5 Days

Transient overexpression lysate of guanine monphosphate synthetase (GMPS)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GMP synthetase / GMPS (1-693, His-tag) Human Protein
AR50228PU-N

USD 1,105.00

2 Weeks

GMP synthetase / GMPS (1-693, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
GMP synthetase / GMPS (1-693, His-tag) Human Protein
AR50228PU-S

USD 415.00

2 Weeks

GMP synthetase / GMPS (1-693, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
GMP Synthase (GMPS) (NM_003875) Human Over-expression Lysate
LC418378

USD 121.00

2 Weeks

GMPS HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GMP Synthase (GMPS) (NM_003875) Human Mass Spec Standard
PH304267

USD 2,055.00

3 Weeks

GMPS MS Standard C13 and N15-labeled recombinant protein (NP_003866)

Tag C-Myc/DDK
Expression Host HEK293
GMP Synthase (GMPS) (NM_003875) ICC Control Block
TB404267

USD 1,260.00

4 Weeks

Transient overexpression of GMPS (NM_003875) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GMP Synthase (GMPS) Cytosection
TS404267

USD 225.00

4 Weeks

Transient overexpression of GMPS (NM_003875) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GMP Synthase (GMPS) Cytosection
TS404267P5

USD 889.00

4 Weeks

Transient overexpression of GMPS (NM_003875) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack