Germany
Japan
United Kingdom
China
PAPSS2 (Myc-DDK-tagged)-Human 3'-phosphoadenosine 5'-phosphosulfate synthase 2 (PAPSS2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
PAPSS2 (Myc-DDK-tagged)-Human 3'-phosphoadenosine 5'-phosphosulfate synthase 2 (PAPSS2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human 3'-phosphoadenosine 5'-phosphosulfate synthase 2 (PAPSS2), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
PAPSS2 (GFP-tagged) - Human 3'-phosphoadenosine 5'-phosphosulfate synthase 2 (PAPSS2), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, PAPSS2 (Myc-DDK tagged) - Human 3'-phosphoadenosine 5'-phosphosulfate synthase 2 (PAPSS2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human 3'-phosphoadenosine 5'-phosphosulfate synthase 2 (PAPSS2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PAPSS2 (mGFP-tagged) - Human 3'-phosphoadenosine 5'-phosphosulfate synthase 2 (PAPSS2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of PAPSS2 (Myc-DDK-tagged)-Human 3'-phosphoadenosine 5'-phosphosulfate synthase 2 (PAPSS2), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PAPSS2 (Myc-DDK-tagged)-Human 3'-phosphoadenosine 5'-phosphosulfate synthase 2 (PAPSS2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of PAPSS2 (mGFP-tagged)-Human 3'-phosphoadenosine 5'-phosphosulfate synthase 2 (PAPSS2), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PAPSS2 (mGFP-tagged)-Human 3'-phosphoadenosine 5'-phosphosulfate synthase 2 (PAPSS2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PAPSS2 (GFP-tagged) - Human 3'-phosphoadenosine 5'-phosphosulfate synthase 2 (PAPSS2), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal Anti-PAPSS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAPSS2 antibody: synthetic peptide directed towards the C terminal of human PAPSS2. Synthetic peptide located within the following region: PARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLEKN |
Lenti ORF clone of Human 3'-phosphoadenosine 5'-phosphosulfate synthase 2 (PAPSS2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
PAPSS2 (untagged)-Human 3'-phosphoadenosine 5'-phosphosulfate synthase 2 (PAPSS2), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of 3'-phosphoadenosine 5'-phosphosulfate synthase 2 (PAPSS2), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PAPSS2 (untagged)-Human 3'-phosphoadenosine 5'-phosphosulfate synthase 2 (PAPSS2), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PAPSS2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PAPSS2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of 3'-phosphoadenosine 5'-phosphosulfate synthase 2 (PAPSS2), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Carrier-free (BSA/glycerol-free) PAPSS2 mouse monoclonal antibody, clone OTI7E8 (formerly 7E8)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PAPSS2 MS Standard C13 and N15-labeled recombinant protein (NP_004661)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
PAPSS2 (untagged)-Human 3'-phosphoadenosine 5'-phosphosulfate synthase 2 (PAPSS2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
PAPSS2 mouse monoclonal antibody, clone OTI7E8 (formerly 7E8)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
PAPSS2 mouse monoclonal antibody, clone OTI7E8 (formerly 7E8), Biotinylated
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
PAPSS2 mouse monoclonal antibody, clone OTI7E8 (formerly 7E8), HRP conjugated
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
PAPSS2 mouse monoclonal antibody, clone OTI7E8 (formerly 7E8)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- PAPSS2
Pathways
- Purine metabolism