Products

cDNA Clones (11)
Antibodies (8)
Proteins (6)
Jump to Filters
View as table Download
PDE3B (NM_000922) Human Tagged ORF Clone
RC219619

USD 600.00

In Stock

PDE3B (Myc-DDK-tagged)-Human phosphodiesterase 3B, cGMP-inhibited (PDE3B)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PDE3B (NM_000922) Human Tagged ORF Clone Lentiviral Particle
RC219619L1V

USD 1,000.00

3 Weeks

Lenti ORF particles, PDE3B (Myc-DDK tagged) - Human phosphodiesterase 3B, cGMP-inhibited (PDE3B), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PDE3B (NM_000922) Human Tagged ORF Clone Lentiviral Particle
RC219619L2V

USD 1,000.00

6 Weeks

Lenti ORF particles, PDE3B (mGFP-tagged) - Human phosphodiesterase 3B, cGMP-inhibited (PDE3B), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PDE3B (NM_000922) Human Tagged ORF Clone Lentiviral Particle
RC219619L3V

USD 1,000.00

5 Weeks

Lenti ORF particles, PDE3B (Myc-DDK tagged) - Human phosphodiesterase 3B, cGMP-inhibited (PDE3B), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE3B (NM_000922) Human Tagged ORF Clone
RC219619L4

USD 800.00

In Stock

Lenti ORF clone of Human phosphodiesterase 3B, cGMP-inhibited (PDE3B), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE3B (NM_000922) Human Tagged ORF Clone Lentiviral Particle
RC219619L4V

USD 1,000.00

3 Weeks

Lenti ORF particles, PDE3B (mGFP-tagged) - Human phosphodiesterase 3B, cGMP-inhibited (PDE3B), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE3B (NM_000922) Human Tagged ORF Clone
RG219619

USD 660.00

3 Weeks

PDE3B (GFP-tagged) - Human phosphodiesterase 3B, cGMP-inhibited (PDE3B)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PDE3B (NM_000922) Human Untagged Clone
SC125326

USD 1,100.00

In Stock

PDE3B (untagged)-Human phosphodiesterase 3B, cGMP-inhibited (PDE3B)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
PDE3B (NM_000922) Human Tagged Lenti ORF Clone
RC219619L1

USD 984.00

In Stock

Lenti ORF clone of Human phosphodiesterase 3B, cGMP-inhibited (PDE3B), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PDE3B Rabbit Polyclonal Antibody
TA319015

USD 355.00

3 Weeks

Rabbit polyclonal anti-PDE3B antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 948 of mouse PDE3B.
PDE3B (Center) Rabbit Polyclonal Antibody
AP53235PU-N

USD 450.00

2 Weeks

PDE3B (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 400-427 amino acids from the Central region of Human PDE3B
PDE3B (NM_000922) Human Tagged ORF Clone
RC219619L2

USD 800.00

3 Weeks

Lenti ORF clone of Human phosphodiesterase 3B, cGMP-inhibited (PDE3B), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PDE3B (NM_000922) Human Over-expression Lysate
LC424435

USD 187.00

In Stock

PDE3B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PDE3B Rabbit Polyclonal Antibody
TA335263

USD 375.00

5 Days

Rabbit Polyclonal Anti-PDE3B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDE3B antibody: synthetic peptide directed towards the middle region of human PDE3B. Synthetic peptide located within the following region: SRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKANDVN
PDE3B Mouse Monoclonal Antibody [Clone ID: OTI3F5]
CF811688

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PDE3B mouse monoclonal antibody,clone OTI3F5

Applications WB
Reactivities Human
Conjugation Unconjugated
PDE3B (NM_000922) Human Mass Spec Standard
PH319619

USD 2,055.00

3 Weeks

PDE3B MS Standard C13 and N15-labeled recombinant protein (NP_000913)

Tag C-Myc/DDK
Expression Host HEK293
PDE3B Mouse Monoclonal Antibody [Clone ID: OTI3F5]
TA811688

USD 379.00

In Stock

PDE3B mouse monoclonal antibody,clone OTI3F5

Applications WB
Reactivities Human
Conjugation Unconjugated
PDE3B Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F5]
TA811688BM

USD 420.00

4 Weeks

PDE3B mouse monoclonal antibody,clone OTI3F5, HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP
PDE3B Mouse Monoclonal Antibody [Clone ID: OTI3F5]
TA811688S

USD 159.00

2 Days

PDE3B mouse monoclonal antibody,clone OTI3F5

Applications WB
Reactivities Human
Conjugation Unconjugated
PDE3B ICC Control Block
TB419619

USD 1,250.00

4 Weeks

Transient overexpression of PDE3B (NM_000922) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PDE3B Cytosection
TS419619

USD 225.00

4 Weeks

Transient overexpression of PDE3B (NM_000922) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PDE3B Cytosection
TS419619P5

USD 889.00

4 Weeks

Transient overexpression of PDE3B (NM_000922) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack