Products

cDNA Clones (21)
Proteins (9)
Antibodies (3)
Jump to Filters
View as table Download
PDE8A (NM_002605) Human Tagged ORF Clone
RC209169

USD 420.00

In Stock

PDE8A (Myc-DDK-tagged)-Human phosphodiesterase 8A (PDE8A), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PDE8A (NM_002605) Human Tagged ORF Clone Lentiviral Particle
RC209169L1V

USD 820.00

3 Weeks

Lenti ORF particles, PDE8A (Myc-DDK tagged) - Human phosphodiesterase 8A (PDE8A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PDE8A (NM_002605) Human Tagged ORF Clone Lentiviral Particle
RC209169L2V

USD 820.00

6 Weeks

Lenti ORF particles, PDE8A (mGFP-tagged) - Human phosphodiesterase 8A (PDE8A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PDE8A (NM_002605) Human Tagged ORF Clone
RG209169

USD 460.00

In Stock

PDE8A (GFP-tagged) - Human phosphodiesterase 8A (PDE8A), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PDE8A (NM_002605) Human Tagged ORF Clone
RC209169L3

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphodiesterase 8A (PDE8A), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE8A (NM_002605) Human Tagged ORF Clone Lentiviral Particle
RC209169L3V

USD 820.00

5 Weeks

Lenti ORF particles, PDE8A (Myc-DDK tagged) - Human phosphodiesterase 8A (PDE8A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE8A (NM_002605) Human Tagged ORF Clone
RC209169L4

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphodiesterase 8A (PDE8A), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE8A (NM_002605) Human Tagged ORF Clone Lentiviral Particle
RC209169L4V

USD 820.00

7 Weeks

Lenti ORF particles, PDE8A (mGFP-tagged) - Human phosphodiesterase 8A (PDE8A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE8A (NM_173454) Human Tagged ORF Clone
RC217197

USD 870.00

4 Weeks

PDE8A (Myc-DDK-tagged)-Human phosphodiesterase 8A (PDE8A), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PDE8A (NM_173454) Human Tagged ORF Clone
RC217197L3

USD 1,070.00

4 Weeks

Lenti-ORF clone of PDE8A (Myc-DDK-tagged)-Human phosphodiesterase 8A (PDE8A), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE8A (NM_173454) Human Tagged ORF Clone Lentiviral Particle
RC217197L3V

USD 1,270.00

7 Weeks

Lenti ORF particles, PDE8A (Myc-DDK-tagged)-Human phosphodiesterase 8A (PDE8A), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE8A (NM_173454) Human Tagged ORF Clone
RC217197L4

USD 1,070.00

4 Weeks

Lenti-ORF clone of PDE8A (mGFP-tagged)-Human phosphodiesterase 8A (PDE8A), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE8A (NM_173454) Human Tagged ORF Clone Lentiviral Particle
RC217197L4V

USD 1,270.00

7 Weeks

Lenti ORF particles, PDE8A (mGFP-tagged)-Human phosphodiesterase 8A (PDE8A), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE8A (NM_001243137) Human Tagged ORF Clone
RC233126

USD 790.00

4 Weeks

PDE8A (Myc-DDK tagged) - Homo sapiens phosphodiesterase 8A (PDE8A), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PDE8A (NM_173454) Human Tagged ORF Clone
RG217197

USD 960.00

5 Weeks

PDE8A (GFP-tagged) - Human phosphodiesterase 8A (PDE8A), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PDE8A (NM_001243137) Human Tagged ORF Clone
RG233126

USD 870.00

4 Weeks

PDE8A (GFP-tagged) - Homo sapiens phosphodiesterase 8A (PDE8A), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PDE8A (NM_002605) Human Untagged Clone
SC101098

USD 310.00

In Stock

PDE8A (untagged)-Human phosphodiesterase 8A (PDE8A), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PDE8A (NM_002605) Human Tagged ORF Clone
RC209169L1

USD 768.00

In Stock

Lenti ORF clone of Human phosphodiesterase 8A (PDE8A), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PDE8A Rabbit Polyclonal Antibody
TA344622

USD 475.00

5 Days

Rabbit Polyclonal Anti-PDE8A Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDE8A antibody: synthetic peptide directed towards the C terminal of human PDE8A. Synthetic peptide located within the following region: VSNPCRPLQYCIEWAARISEEYFSQTDEEKQQGLPVVMPVFDRNTCSIPK
PDE8A Rabbit Polyclonal Antibody
TA344623

USD 475.00

5 Days

Rabbit Polyclonal Anti-PDE8A Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDE8A antibody: synthetic peptide directed towards the C terminal of human PDE8A. Synthetic peptide located within the following region: SSNPYHNSTHSADVLHATAYFLSKERIKETLDPIDEVAALIAATIHDVDH
PDE8A (NM_002605) Human Tagged ORF Clone
RC209169L2

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphodiesterase 8A (PDE8A), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PDE8A Rabbit Polyclonal Antibody
TA317155

USD 425.00

5 Days

PDE8A Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Dog, Gorilla, Horse, Human, Pig, Rabbit
Conjugation Unconjugated
Immunogen PDE8A antibody was raised against synthetic 16 amino acid peptide from near N-terminus of human PDE8A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Dog, Panda, Horse, Rabbit, Pig (100%); Marmoset (94%); Mouse, Rat, Bovine, Elephant, Opossum (88%); Platypus, Zebrafish (81%).
PDE8A (NM_002605) Human Over-expression Lysate
LC419223

USD 121.00

2 Weeks

PDE8A HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PDE8A (NM_002605) Human Over-expression Lysate
LY419223

USD 396.00

5 Days

Transient overexpression lysate of phosphodiesterase 8A (PDE8A), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PDE8A (NM_173454) Human Untagged Clone
SC306815

USD 1,590.00

5 Weeks

PDE8A (untagged)-Human phosphodiesterase 8A (PDE8A), transcript variant 2

Vector pCMV6 series
Tag Tag Free
PDE8A (NM_001243137) Human Untagged Clone
SC330089

USD 760.00

4 Weeks

PDE8A (untagged) - Homo sapiens phosphodiesterase 8A (PDE8A), transcript variant 3

Vector pCMV6 series
Tag Tag Free
PDE8A ICC Control Block
TB409169

USD 1,070.00

4 Weeks

Transient overexpression of PDE8A (NM_002605) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PDE8A ICC Control Block
TB417197

USD 1,520.00

4 Weeks

Transient overexpression of PDE8A (NM_173454) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PDE8A ICC Control Block
TB433126

USD 1,440.00

4 Weeks

Transient overexpression of PDE8A (NM_001243137) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PDE8A Cytosection
TS409169

USD 225.00

4 Weeks

Transient overexpression of PDE8A (NM_002605) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PDE8A Cytosection
TS409169P5

USD 889.00

4 Weeks

Transient overexpression of PDE8A (NM_002605) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

PDE8A ICC Control Sections
TS417197P5

USD 889.00

4 Weeks

Transient overexpression of PDE8A (NM_173454) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

PDE8A ICC Control Sections
TS433126P5

USD 889.00

4 Weeks

Transient overexpression of PDE8A (NM_001243137) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack