Products

cDNA Clones (41)
Proteins (34)
Antibodies (18)
Jump to Filters
View as table Download
PKM2 (PKM) (NM_182470) Human Tagged ORF Clone
RC219382

USD 420.00

In Stock

PKM (Myc-DDK-tagged)-Human pyruvate kinase, muscle (PKM2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PKM2 (PKM) (NM_002654) Human Tagged ORF Clone
RC201855

USD 420.00

In Stock

PKM (Myc-DDK-tagged)-Human pyruvate kinase, muscle (PKM2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PKM2 (PKM) (NM_182471) Human Tagged ORF Clone
RC222698

USD 420.00

In Stock

PKM (Myc-DDK-tagged)-Human pyruvate kinase, muscle (PKM2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PKM2 (PKM) (NM_002654) Human Tagged ORF Clone
RG201855

USD 460.00

In Stock

PKM (GFP-tagged) - Human pyruvate kinase, muscle (PKM2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PKM2 (PKM) (NM_182471) Human Tagged ORF Clone
RG222698

USD 460.00

In Stock

PKM (GFP-tagged) - Human pyruvate kinase, muscle (PKM2), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PKM2 (PKM) (NM_001206796) Human Tagged ORF Clone
RC234549

USD 480.00

In Stock

PKM (Myc-DDK tagged) - Homo sapiens pyruvate kinase, muscle (PKM), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PKM2 (PKM) (NM_182470) Human Tagged ORF Clone
RG219382

USD 460.00

In Stock

PKM (GFP-tagged) - Human pyruvate kinase, muscle (PKM2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PKM2 (PKM) (NM_002654) Human Tagged ORF Clone
RC201855L4

USD 620.00

In Stock

Lenti-ORF clone of PKM (mGFP-tagged)-Human pyruvate kinase, muscle (PKM2), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PKM2 (PKM) (NM_182470) Human Tagged ORF Clone
RC219382L3

USD 620.00

3 Weeks

Lenti ORF clone of Human pyruvate kinase, muscle (PKM2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PKM2 (PKM) (NM_182470) Human Tagged ORF Clone
RC219382L4

USD 620.00

In Stock

Lenti ORF clone of Human pyruvate kinase, muscle (PKM2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PKM2 (PKM) (NM_182471) Human Tagged ORF Clone
RC222698L3

USD 620.00

3 Weeks

Lenti-ORF clone of PKM (Myc-DDK-tagged)-Human pyruvate kinase, muscle (PKM2), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PKM2 (PKM) (NM_182471) Human Tagged ORF Clone
RC222698L4

USD 620.00

3 Weeks

Lenti-ORF clone of PKM (mGFP-tagged)-Human pyruvate kinase, muscle (PKM2), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PKM2 (PKM) (NM_001206797) Human Tagged ORF Clone
RC234154

USD 420.00

5 Weeks

PKM (Myc-DDK tagged) - Homo sapiens pyruvate kinase, muscle (PKM), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PKM2 (PKM) (NM_001206798) Human Tagged ORF Clone
RC234328

USD 480.00

5 Weeks

PKM (Myc-DDK tagged) - Homo sapiens pyruvate kinase, muscle (PKM), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PKM2 (PKM) (NM_001206799) Human Tagged ORF Clone
RC234374

USD 480.00

2 Weeks

PKM (Myc-DDK tagged) - Homo sapiens pyruvate kinase, muscle (PKM), transcript variant 7

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PKM2 (PKM) (NM_001206797) Human Tagged ORF Clone
RG234154

USD 460.00

5 Weeks

PKM (GFP-tagged) - Homo sapiens pyruvate kinase, muscle (PKM), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PKM2 (PKM) (NM_001206798) Human Tagged ORF Clone
RG234328

USD 530.00

5 Weeks

PKM (GFP-tagged) - Homo sapiens pyruvate kinase, muscle (PKM), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PKM2 (PKM) (NM_001206799) Human Tagged ORF Clone
RG234374

USD 530.00

5 Weeks

PKM (GFP-tagged) - Homo sapiens pyruvate kinase, muscle (PKM), transcript variant 7

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PKM2 (PKM) (NM_001206796) Human Tagged ORF Clone
RG234549

USD 530.00

3 Weeks

PKM (GFP-tagged) - Homo sapiens pyruvate kinase, muscle (PKM), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PKM2 (PKM) (NM_002654) Human Untagged Clone
SC315792

USD 760.00

In Stock

PKM (untagged)-Human pyruvate kinase, muscle (PKM2), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
PKM2 (PKM) Rabbit Polyclonal Antibody
TA326808

USD 275.00

3 Weeks

PKM2 Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant Protein of human PKM2
PKM2 (PKM) (Isoform M1) Rabbit Polyclonal Antibody
AP26075PU-N

USD 300.00

In Stock

PKM2 (PKM) (Isoform M1) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse
Immunogen Peptide sequence around aa. 399~403 derived from Human PKM1.
PKM2 (PKM) Rabbit Polyclonal Antibody
TA344600

USD 475.00

5 Days

Rabbit Polyclonal Anti-PKM2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PKM2 antibody: synthetic peptide directed towards the middle region of human PKM2. Synthetic peptide located within the following region: HLQLFEELRRLAPITSDPTEATAVGAVEASFKCCSGAIIVLTKSGRSAHQ
PKM2 (PKM) (Isoform M1) Rabbit Polyclonal Antibody
AP26075PU-S

USD 230.00

2 Weeks

PKM2 (PKM) (Isoform M1) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse
Immunogen Peptide sequence around aa. 399~403 derived from Human PKM1.
PKM2 (1-531, His-tag) Human Protein
AR09312PU-L

USD 745.00

2 Weeks

PKM2 (1-531, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
PKM2 (PKM) (NM_002654) Human Over-expression Lysate
LY419188

USD 396.00

In Stock

Transient overexpression lysate of pyruvate kinase, muscle (PKM2), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PKM2 (PKM) (NM_182470) Human Untagged Clone
SC313887

USD 900.00

In Stock

PKM (untagged)-Human pyruvate kinase, muscle (PKM2), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PKM2 (1-531, His-tag) Human Protein
AR09312PU-N

USD 300.00

2 Weeks

PKM2 (1-531, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
PKM2 (PKM) (NM_182471) Human Over-expression Lysate
LY405538

USD 605.00

In Stock

Transient overexpression lysate of pyruvate kinase, muscle (PKM2), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PKM2 (PKM) (NM_182470) Human Tagged ORF Clone
RC219382L1

USD 620.00

In Stock

Lenti ORF clone of Human pyruvate kinase, muscle (PKM2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PKM2 (PKM) Rabbit Polyclonal Antibody
TA309804

USD 424.00

In Stock

Rabbit Polyclonal PKM2 Antibody

Applications WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to the internal region of human PKM2 protein (within residues 350-450). [Swiss-Prot# P14618]
PKM2 (PKM) Rabbit Polyclonal Antibody
TA344601

USD 475.00

5 Days

Rabbit Polyclonal Anti-PKM2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PKM2 antibody: synthetic peptide directed towards the N terminal of human PKM2. Synthetic peptide located within the following region: MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICT
PKM2 (PKM) Rabbit Polyclonal Antibody
TA347826

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-PKM2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PKM2 Antibody: Peptide sequence around aa.405~409(T-S-D-P-T) derived from Human PKM2.
PKM2 (PKM) (N-term) Rabbit Polyclonal Antibody
AP53318PU-N

USD 450.00

2 Weeks

PKM2 (PKM) (N-term) rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 123~153 amino acids from the N-terminal region of Human PKM2.
PKM2 (PKM) (NM_182470) Human Tagged ORF Clone
RC219382L2

USD 620.00

3 Weeks

Lenti ORF clone of Human pyruvate kinase, muscle (PKM2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PKM2 (PKM) (NM_182471) Human Tagged ORF Clone
RC222698L2

USD 620.00

3 Weeks

Lenti-ORF clone of PKM (mGFP-tagged)-Human pyruvate kinase, muscle (PKM2), transcript variant 3

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PKM2 (PKM) (NM_182471) Human Untagged Clone
SC313888

USD 760.00

In Stock

PKM (untagged)-Human pyruvate kinase, muscle (PKM2), transcript variant 3

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None