Products

Proteins (9)
cDNA Clones (7)
Antibodies (1)
Jump to Filters
View as table Download
POLR2K (NM_005034) Human Tagged ORF Clone
RC201957

USD 98.00

USD 390.00

In Stock

POLR2K (Myc-DDK-tagged)-Human polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
POLR2K (NM_005034) Human Tagged ORF Clone
RG201957

USD 460.00

In Stock

POLR2K (GFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
POLR2K (NM_005034) Human Tagged ORF Clone
RC201957L3

USD 620.00

3 Weeks

Lenti ORF clone of Human polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR2K (NM_005034) Human Tagged ORF Clone Lentiviral Particle
RC201957L3V

USD 820.00

6 Weeks

Lenti ORF particles, POLR2K (Myc-DDK tagged) - Human polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR2K (NM_005034) Human Tagged ORF Clone
RC201957L4

USD 620.00

3 Weeks

Lenti ORF clone of Human polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR2K (NM_005034) Human Tagged ORF Clone Lentiviral Particle
RC201957L4V

USD 820.00

6 Weeks

Lenti ORF particles, POLR2K (mGFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR2K Rabbit Polyclonal Antibody
TA346735

USD 475.00

5 Days

Rabbit Polyclonal Anti-POLR2K Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLR2K antibody: synthetic peptide directed towards the middle region of human POLR2K. Synthetic peptide located within the following region: DTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKR
POLR2K (NM_005034) Human Untagged Clone
SC116985

USD 310.00

In Stock

POLR2K (untagged)-Human polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
POLR2K (1-58, His-tag) Human Protein
AR51712PU-N

USD 1,105.00

2 Weeks

POLR2K (1-58, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
POLR2K (1-58, His-tag) Human Protein
AR51712PU-S

USD 415.00

2 Weeks

POLR2K (1-58, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
POLR2K (NM_005034) Human Over-expression Lysate
LC417596

USD 121.00

2 Weeks

POLR2K HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
POLR2K (NM_005034) Human Over-expression Lysate
LY417596

USD 396.00

5 Days

Transient overexpression lysate of polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
POLR2K (NM_005034) Human Mass Spec Standard
PH301957

USD 2,055.00

3 Weeks

POLR2K MS Standard C13 and N15-labeled recombinant protein (NP_005025)

Tag C-Myc/DDK
Expression Host HEK293
POLR2K ICC Control Block
TB401957

USD 1,040.00

4 Weeks

Transient overexpression of POLR2K (NM_005034) in HEK293T cells paraffin embedded controls for ICC/IHC staining

POLR2K Cytosection
TS401957

USD 225.00

4 Weeks

Transient overexpression of POLR2K (NM_005034) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

POLR2K Cytosection
TS401957P5

USD 889.00

4 Weeks

Transient overexpression of POLR2K (NM_005034) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack