Germany
Japan
United Kingdom
China
POLR2K (Myc-DDK-tagged)-Human polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Polr2k (Myc-DDK-tagged) - Mouse polymerase (RNA) II (DNA directed) polypeptide K (Polr2k), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
POLR2K (GFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
POLR2K - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN401957 is the updated version of KN201957.
Polr2k - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN513607 is the updated version of KN313607.
Polr2k (GFP-tagged) - Mouse polymerase (RNA) II (DNA directed) polypeptide K (cDNA clone MGC:41431 IMAGE:3468916)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Polr2k (GFP-tagged) - Mouse polymerase (RNA) II (DNA directed) polypeptide K (Polr2k) transcript variant 1, (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Polr2k (Myc-DDK-tagged) - Mouse polymerase (RNA) II (DNA directed) polypeptide K (Polr2k), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Polr2k (Myc-DDK-tagged) - Mouse polymerase (RNA) II (DNA directed) polypeptide K (Polr2k), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Polr2k (mGFP-tagged) - Mouse polymerase (RNA) II (DNA directed) polypeptide K (Polr2k), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Polr2k (GFP-tagged) - Mouse polymerase (RNA) II (DNA directed) polypeptide K (Polr2k), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Polr2k (Myc-DDK-tagged) - Mouse polymerase (RNA) II (DNA directed) polypeptide K (Polr2k), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Polr2k (Myc-DDK-tagged) - Mouse polymerase (RNA) II (DNA directed) polypeptide K (Polr2k), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Polr2k (Myc-DDK-tagged) - Mouse polymerase (RNA) II (DNA directed) polypeptide K (Polr2k), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Polr2k (mGFP-tagged) - Mouse polymerase (RNA) II (DNA directed) polypeptide K (Polr2k), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Polr2k (GFP-tagged) - Mouse polymerase (RNA) II (DNA directed) polypeptide K (Polr2k), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, POLR2K (Myc-DDK tagged) - Human polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, POLR2K (mGFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Polr2k (myc-DDK-tagged) - Rat polymerase (RNA) II (DNA directed) polypeptide K (Polr2k)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal Anti-POLR2K Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLR2K antibody: synthetic peptide directed towards the middle region of human POLR2K. Synthetic peptide located within the following region: DTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKR |
Polr2k (untagged) - Mouse polymerase (RNA) II (DNA directed) polypeptide K (cDNA clone MGC:41431 IMAGE:3468916), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
POLR2K (untagged)-Human polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
POLR2K (1-58, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
| Expression Host | E. coli |
POLR2K (1-58, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
POLR2K CRISPRa kit - CRISPR gene activation of human RNA polymerase II subunit K
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Polr2k CRISPRa kit - CRISPR gene activation of mouse polymerase (RNA) II (DNA directed) polypeptide K
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene POLR2K
| Application | Plasmid of exact quantity for transcript copy number calculation |
POLR2K HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qSTAR qPCR primer pairs against Mus musculus gene Polr2k
AAV ORF Particles, serotype AAV-2, Polr2k (Myc-DDK-tagged) - Mouse polymerase (RNA) II (DNA directed) polypeptide K (Polr2k), transcript variant 2, 250ul, >10^13 TU/mL
- AAV ORF®
-
POLR2K MS Standard C13 and N15-labeled recombinant protein (NP_005025)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
AAV ORF Particles, serotype AAV-2, POLR2K (Myc-DDK-tagged)-Human polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K), 250ul, >10^13 TU/mL
- AAV ORF®
-
Polr2k (untagged) - Rat polymerase (RNA) II (DNA directed) polypeptide K (Polr2k)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of polymerase (RNA) II (DNA directed) polypeptide K 7.0kDa (POLR2K) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
POLR2K (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Polr2k (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
POLR2K rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
POLR2K Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-58 of human POLR2K (NP_005025.1). |
| Modifications | Unmodified |
Transient overexpression of POLR2K (NM_005034) in HEK293T cells paraffin embedded controls for ICC/IHC staining
POLR2K - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
POLR2K - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Polr2k - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Polr2k - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Purified recombinant protein of Mouse polymerase (RNA) II (DNA directed) polypeptide K (Polr2k), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
| Tag | C-MYC/DDK |
| Expression Host | HEK293T |
POLR2K - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
Active filters
Target Symbol
- POLR2K