Products

cDNA Clones (28)
Proteins (27)
Antibodies (12)
Jump to Filters
View as table Download
POLR3H (NM_138338) Human Tagged ORF Clone
RC220534

USD 420.00

In Stock

POLR3H (Myc-DDK-tagged)-Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
POLR3H (NM_001018052) Human Tagged ORF Clone
RC205709

USD 98.00

USD 390.00

In Stock

POLR3H (Myc-DDK-tagged)-Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
POLR3H (NM_001018050) Human Tagged ORF Clone
RC210633

USD 98.00

USD 390.00

In Stock

POLR3H (Myc-DDK-tagged)-Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
POLR3H (NM_001282884) Human Tagged ORF Clone
RC236539

USD 420.00

In Stock

POLR3H (myc-DDK-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
POLR3H (NM_001282885) Human Tagged ORF Clone
RC236540

USD 420.00

In Stock

POLR3H (myc-DDK-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
POLR3H (NM_001018052) Human Tagged ORF Clone
RG205709

USD 460.00

In Stock

POLR3H (GFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
POLR3H (NM_138338) Human Tagged ORF Clone
RG220534

USD 460.00

In Stock

POLR3H (GFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
POLR3H (NM_001018052) Human Tagged ORF Clone
RC205709L3

USD 620.00

3 Weeks

Lenti ORF clone of Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR3H (NM_001018052) Human Tagged ORF Clone Lentiviral Particle
RC205709L3V

USD 820.00

6 Weeks

Lenti ORF particles, POLR3H (Myc-DDK tagged) - Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR3H (NM_001018052) Human Tagged ORF Clone
RC205709L4

USD 620.00

3 Weeks

Lenti ORF clone of Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR3H (NM_001018052) Human Tagged ORF Clone Lentiviral Particle
RC205709L4V

USD 820.00

6 Weeks

Lenti ORF particles, POLR3H (mGFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR3H (NM_001018050) Human Tagged ORF Clone
RC210633L3

USD 620.00

3 Weeks

Lenti ORF clone of Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR3H (NM_001018050) Human Tagged ORF Clone Lentiviral Particle
RC210633L3V

USD 820.00

6 Weeks

Lenti ORF particles, POLR3H (Myc-DDK tagged) - Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR3H (NM_001018050) Human Tagged ORF Clone
RC210633L4

USD 620.00

3 Weeks

Lenti ORF clone of Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR3H (NM_001018050) Human Tagged ORF Clone Lentiviral Particle
RC210633L4V

USD 820.00

6 Weeks

Lenti ORF particles, POLR3H (mGFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR3H (NM_138338) Human Tagged ORF Clone
RC220534L3

USD 620.00

3 Weeks

Lenti ORF clone of Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR3H (NM_138338) Human Tagged ORF Clone Lentiviral Particle
RC220534L3V

USD 820.00

6 Weeks

Lenti ORF particles, POLR3H (Myc-DDK tagged) - Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR3H (NM_138338) Human Tagged ORF Clone
RC220534L4

USD 620.00

3 Weeks

Lenti ORF clone of Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR3H (NM_138338) Human Tagged ORF Clone Lentiviral Particle
RC220534L4V

USD 820.00

6 Weeks

Lenti ORF particles, POLR3H (mGFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR3H (NM_001018050) Human Tagged ORF Clone
RG210633

USD 460.00

3 Weeks

POLR3H (GFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
POLR3H Rabbit Polyclonal Antibody
TA346687

USD 475.00

5 Days

Rabbit Polyclonal Anti-POLR3H Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLR3H antibody: synthetic peptide directed towards the middle region of human POLR3H. Synthetic peptide located within the following region: AHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTL
POLR3H Rabbit Polyclonal Antibody
TA316209

USD 345.00

In Stock

Rabbit polyclonal anti-POLR3H (RPC8) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPC8.
POLR3H (NM_001018050) Human Over-expression Lysate
LC422705

USD 121.00

In Stock

POLR3H HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
POLR3H (NM_138338) Human Over-expression Lysate
LY408616

USD 396.00

5 Days

Transient overexpression lysate of polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
POLR3H (BC017248) Human Untagged Clone
SC106278

USD 310.00

In Stock

POLR3H (untagged)-Homo sapiens, clone MGC:29654 IMAGE:4892259, complete cds

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
POLR3H (NM_138338) Human Untagged Clone
SC111545

USD 420.00

In Stock

POLR3H (untagged)-Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
POLR3H (NM_001018050) Human Untagged Clone
SC323888

USD 420.00

In Stock

POLR3H (untagged)-Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 3

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
POLR3H (1-204, His-tag) Human Protein
AR50579PU-N

USD 845.00

2 Weeks

POLR3H (1-204, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
POLR3H (1-204, His-tag) Human Protein
AR50579PU-S

USD 330.00

2 Weeks

POLR3H (1-204, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
POLR3H Mouse Monoclonal Antibody [Clone ID: OTI4D8]
CF809432

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) POLR3H mouse monoclonal antibody,clone OTI4D8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
POLR3H Mouse Monoclonal Antibody [Clone ID: OTI5A12]
CF809442

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) POLR3H mouse monoclonal antibody,clone OTI5A12

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
POLR3H (NM_138338) Human Over-expression Lysate
LC408616

USD 121.00

2 Weeks

POLR3H HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
POLR3H (NM_001018052) Human Over-expression Lysate
LC422706

USD 121.00

2 Weeks

POLR3H HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
POLR3H (NM_001018050) Human Over-expression Lysate
LC425419

USD 121.00

2 Weeks

POLR3H HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
POLR3H (NM_001018050) Human Over-expression Lysate
LY422705

USD 396.00

5 Days

Transient overexpression lysate of polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY422705 is the same product as LY425419.
POLR3H (NM_001018052) Human Over-expression Lysate
LY422706

USD 396.00

5 Days

Transient overexpression lysate of polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
POLR3H (NM_001018050) Human Over-expression Lysate
LY425419

USD 396.00

5 Days

Transient overexpression lysate of polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
POLR3H (NM_001018050) Human Mass Spec Standard
PH310633

USD 2,055.00

3 Weeks

POLR3H MS Standard C13 and N15-labeled recombinant protein (NP_001018060)

Tag C-Myc/DDK
Expression Host HEK293
POLR3H (NM_001282884) Human Tagged ORF Clone
RG236539

USD 460.00

2 Weeks

POLR3H (GFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
POLR3H (NM_001282885) Human Tagged ORF Clone
RG236540

USD 460.00

2 Weeks

POLR3H (GFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
POLR3H (NM_001018052) Human Untagged Clone
SC302142

USD 420.00

3 Weeks

POLR3H (untagged)-Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
POLR3H (NM_001282884) Human Untagged Clone
SC334433

USD 341.00

2 Weeks

POLR3H (untagged) - Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 5

Vector pCMV6-Entry
Tag Tag Free
POLR3H (NM_001282885) Human Untagged Clone
SC334434

USD 341.00

2 Weeks

POLR3H (untagged) - Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 6

Vector pCMV6-Entry
Tag Tag Free
POLR3H Mouse Monoclonal Antibody [Clone ID: OTI4D8]
TA809432

USD 379.00

In Stock

POLR3H mouse monoclonal antibody,clone OTI4D8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
POLR3H Mouse Monoclonal Antibody [Clone ID: OTI4D8]
TA809432S

USD 159.00

2 Days

POLR3H mouse monoclonal antibody,clone OTI4D8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
POLR3H Mouse Monoclonal Antibody [Clone ID: OTI5A12]
TA809442

USD 379.00

In Stock

POLR3H mouse monoclonal antibody,clone OTI5A12

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated