XDH (Myc-DDK-tagged)-Human xanthine dehydrogenase (XDH)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
XDH (Myc-DDK-tagged)-Human xanthine dehydrogenase (XDH)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human xanthine dehydrogenase (XDH)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 1,800.00
3 Weeks
Lenti ORF particles, XDH (Myc-DDK tagged) - Human xanthine dehydrogenase (XDH), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 1,800.00
6 Weeks
Lenti ORF particles, XDH (mGFP-tagged) - Human xanthine dehydrogenase (XDH), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
XDH (GFP-tagged) - Human xanthine dehydrogenase (XDH)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human xanthine dehydrogenase (XDH), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,800.00
5 Weeks
Lenti ORF particles, XDH (Myc-DDK tagged) - Human xanthine dehydrogenase (XDH), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human xanthine dehydrogenase (XDH), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,800.00
7 Weeks
Lenti ORF particles, XDH (mGFP-tagged) - Human xanthine dehydrogenase (XDH), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human xanthine dehydrogenase (XDH), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
XDH HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
XDH (untagged)-Human xanthine dehydrogenase (XDH)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Transient overexpression lysate of xanthine dehydrogenase (XDH)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human xanthine dehydrogenase (XDH), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Xanthine Oxidase (XDH) guinea pig polyclonal antibody, Serum
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Immunogen | Xanthine Oxidase purified from Bovine Milk Fat Globule Membrane (MFGM). |
Xanthine Oxidase (XDH) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 213~242 amino acids from the N-terminal region of human XDH |
Rabbit Polyclonal Anti-XDH Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Xdh antibody is: synthetic peptide directed towards the N-terminal region of Rat Xdh. Synthetic peptide located within the following region: EFFSAFKQASRREDDIAKVTSGMRVLFKPGTIEVQELSLCFGGMADRTIS |
Carrier-free (BSA/glycerol-free) XDH mouse monoclonal antibody,clone OTI5D8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) XDH mouse monoclonal antibody,clone OTI1C10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
XDH MS Standard C13 and N15-labeled recombinant protein (NP_000370)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
XDH mouse monoclonal antibody,clone OTI5D8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
XDH mouse monoclonal antibody,clone OTI5D8, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
XDH mouse monoclonal antibody,clone OTI5D8, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
XDH mouse monoclonal antibody,clone OTI5D8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
XDH mouse monoclonal antibody,clone OTI1C10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
XDH mouse monoclonal antibody,clone OTI1C10, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
XDH mouse monoclonal antibody,clone OTI1C10, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
XDH mouse monoclonal antibody,clone OTI1C10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression of XDH (NM_000379) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of XDH (NM_000379) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of XDH (NM_000379) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack