Products

cDNA Clones (7)
Proteins (5)
Antibodies (4)
Jump to Filters
View as table Download
NT5C1A (NM_032526) Human Recombinant Protein
TP324617

USD 823.00

In Stock

Purified recombinant protein of Homo sapiens 5'-nucleotidase, cytosolic IA (NT5C1A)

Tag C-Myc/DDK
Expression Host HEK293T
NT5C1A (NM_032526) Human Tagged ORF Clone
RG224617

USD 460.00

In Stock

NT5C1A (GFP-tagged) - Human 5'-nucleotidase, cytosolic IA (NT5C1A)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NT5C1A (NM_032526) Human Tagged ORF Clone
RC224617

USD 420.00

In Stock

NT5C1A (Myc-DDK-tagged)-Human 5'-nucleotidase, cytosolic IA (NT5C1A)

Vector pCMV6-Entry2
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
NT5C1A (NM_032526) Human Tagged ORF Clone
RC224617L3

USD 620.00

3 Weeks

Lenti-ORF clone of NT5C1A (Myc-DDK-tagged)-Human 5'-nucleotidase, cytosolic IA (NT5C1A)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NT5C1A (NM_032526) Human Tagged ORF Clone
RC224617L4

USD 620.00

3 Weeks

Lenti-ORF clone of NT5C1A (mGFP-tagged)-Human 5'-nucleotidase, cytosolic IA (NT5C1A)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NT5C1A (NM_032526) Human Tagged ORF Clone Lentiviral Particle
RC224617L4V

USD 820.00

6 Weeks

Lenti ORF particles, NT5C1A (mGFP-tagged)-Human 5'-nucleotidase, cytosolic IA (NT5C1A), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NT5C1A (NM_032526) Human Untagged Clone
SC305464

USD 630.00

In Stock

NT5C1A (untagged)-Human 5'-nucleotidase, cytosolic IA (NT5C1A)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
NT5C1A Rabbit Polyclonal Antibody
TA315925

USD 345.00

In Stock

Rabbit polyclonal anti-NT5C1A antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NT5C1A.
NT5C1A (N-term) Rabbit Polyclonal Antibody
AP50003PU-N

USD 450.00

2 Weeks

NT5C1A (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 98~127 amino acids from the N-terminal region of human 5NT1A
NT5C1A Rabbit Polyclonal Antibody
TA342921

USD 375.00

5 Days

Rabbit Polyclonal Anti-NT5C1A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NT5C1A antibody: synthetic peptide directed towards the C terminal of human NT5C1A. Synthetic peptide located within the following region: AHGLDRFFEHEKAHENKPLAQGPLKGFLEALGRLQKKFYSKGLRLECPIR
NT5C1A (NM_032526) Human Mass Spec Standard
PH324617

USD 2,055.00

3 Weeks

NT5C1A MS Standard C13 and N15-labeled recombinant protein (NP_115915)

Tag C-Myc/DDK
Expression Host HEK293
NT5C1A Rabbit Polyclonal Antibody
TA350240

USD 345.00

In Stock

Rabbit Polyclonal Anti-NT5C1A Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human NT5C1A
NT5C1A (NM_032526) ICC Control Block
TB424617

USD 1,070.00

4 Weeks

Transient overexpression of NT5C1A (NM_032526) in HEK293T cells paraffin embedded controls for ICC/IHC staining

NT5C1A Cytosection
TS424617

USD 225.00

4 Weeks

Transient overexpression of NT5C1A (NM_032526) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

NT5C1A Cytosection
TS424617P5

USD 889.00

4 Weeks

Transient overexpression of NT5C1A (NM_032526) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack