Products

Proteins (9)
cDNA Clones (8)
Antibodies (2)
Jump to Filters
View as table Download
Nucleoside phosphorylase (PNP) (NM_000270) Human Tagged ORF Clone Lentiviral Particle
RC210759L3V

USD 820.00

6 Weeks

Lenti ORF particles, PNP (Myc-DDK tagged) - Human purine nucleoside phosphorylase (PNP), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Nucleoside phosphorylase (PNP) Rabbit Polyclonal Antibody
TA346671

USD 475.00

5 Days

Rabbit Polyclonal Anti-NP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NP antibody: synthetic peptide directed towards the middle region of human NP. Synthetic peptide located within the following region: GVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFG
Nucleoside phosphorylase (PNP) (NM_000270) Human Untagged Clone
SC322018

USD 660.00

In Stock

PNP (untagged)-Human purine nucleoside phosphorylase (PNP)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Nucleoside phosphorylase (PNP) Rabbit Polyclonal Antibody
TA332910

USD 275.00

3 Weeks

Rabbit anti-PNP Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PNP
Nucleoside phosphorylase (PNP) (NM_000270) Human Over-expression Lysate
LC424829

USD 121.00

In Stock

PNP HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NP (1-289, His-tag) Human Protein
AR09725PU-L

USD 845.00

2 Weeks

NP (1-289, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
NP (1-289, His-tag) Human Protein
AR09725PU-N

USD 330.00

2 Weeks

NP (1-289, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
Nucleoside phosphorylase (PNP) (NM_000270) Human Over-expression Lysate
LY424829

USD 396.00

5 Days

Transient overexpression lysate of purine nucleoside phosphorylase (PNP)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Nucleoside phosphorylase (PNP) (NM_000270) Human Mass Spec Standard
PH310759

USD 2,055.00

3 Weeks

PNP MS Standard C13 and N15-labeled recombinant protein (NP_000261)

Tag C-Myc/DDK
Expression Host HEK293
Nucleoside phosphorylase (PNP) ICC Control Block
TB410759

USD 1,070.00

4 Weeks

Transient overexpression of PNP (NM_000270) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Nucleoside phosphorylase (PNP) Cytosection
TS410759

USD 225.00

4 Weeks

Transient overexpression of PNP (NM_000270) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Nucleoside phosphorylase (PNP) Cytosection
TS410759P5

USD 889.00

4 Weeks

Transient overexpression of PNP (NM_000270) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack