Products

View as table Download

PDGFD (Myc-DDK-tagged)-Human platelet derived growth factor D (PDGFD), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

PDGFD (Myc-DDK-tagged)-Human platelet derived growth factor D (PDGFD), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

PDGFD (GFP-tagged) - Human platelet derived growth factor D (PDGFD), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

PDGFD (GFP-tagged) - Human platelet derived growth factor D (PDGFD), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human platelet derived growth factor D (PDGFD), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PDGFD (Myc-DDK tagged) - Human platelet derived growth factor D (PDGFD), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human platelet derived growth factor D (PDGFD), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PDGFD (mGFP-tagged) - Human platelet derived growth factor D (PDGFD), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human platelet derived growth factor D (PDGFD), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PDGFD (Myc-DDK tagged) - Human platelet derived growth factor D (PDGFD), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human platelet derived growth factor D (PDGFD), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PDGFD (mGFP-tagged) - Human platelet derived growth factor D (PDGFD), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Purified recombinant protein of Human platelet derived growth factor D (PDGFD), transcript variant 1, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli

PDGFD (untagged)-Human platelet derived growth factor D (PDGFD), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF clone of Human platelet derived growth factor D (PDGFD), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

PDGFD (untagged)-Human platelet derived growth factor D (PDGFD), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF clone of Human platelet derived growth factor D (PDGFD), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal Anti-PDGFD Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDGFD antibody: synthetic peptide directed towards the N terminal of human PDGFD. Synthetic peptide located within the following region: NANLRRDESNHLTDLYRRDETIQVKGNGYVQSPRFPNSYPRNLLLTWRLH

PDGFD HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

PDGFD (250-370, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli

PDGFD (250-370, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli

Carrier-free (BSA/glycerol-free) PDGFD mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDGFD HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

PDGFD mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDGFD mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Transient overexpression of PDGFD (NM_033135) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of PDGFD (NM_025208) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of PDGFD (NM_033135) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of PDGFD (NM_033135) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of PDGFD (NM_025208) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of PDGFD (NM_025208) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack