Products

cDNA Clones (15)
Proteins (7)
Antibodies (5)
Jump to Filters
View as table Download
Apg12 (ATG12) (NM_004707) Human Tagged ORF Clone
RC202012

USD 98.00

USD 390.00

In Stock

ATG12 (Myc-DDK-tagged)-Human ATG12 autophagy related 12 homolog (S. cerevisiae) (ATG12), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Apg12 (ATG12) (NM_004707) Human Tagged ORF Clone Lentiviral Particle
RC202012L1V

USD 820.00

3 Weeks

Lenti ORF particles, ATG12 (Myc-DDK tagged) - Human ATG12 autophagy related 12 homolog (S. cerevisiae) (ATG12), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
Apg12 (ATG12) (NM_004707) Human Tagged ORF Clone Lentiviral Particle
RC202012L2V

USD 820.00

6 Weeks

Lenti ORF particles, ATG12 (mGFP-tagged) - Human ATG12 autophagy related 12 homolog (S. cerevisiae) (ATG12), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Apg12 (ATG12) (NM_004707) Human Tagged ORF Clone
RG202012

USD 460.00

In Stock

ATG12 (GFP-tagged) - Human ATG12 autophagy related 12 homolog (S. cerevisiae) (ATG12), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Apg12 (ATG12) (NM_004707) Human Tagged ORF Clone
RC202012L3

USD 620.00

3 Weeks

Lenti ORF clone of Human ATG12 autophagy related 12 homolog (S. cerevisiae) (ATG12), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Apg12 (ATG12) (NM_004707) Human Tagged ORF Clone Lentiviral Particle
RC202012L3V

USD 820.00

5 Weeks

Lenti ORF particles, ATG12 (Myc-DDK tagged) - Human ATG12 autophagy related 12 homolog (S. cerevisiae) (ATG12), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Apg12 (ATG12) (NM_004707) Human Tagged ORF Clone
RC202012L4

USD 620.00

3 Weeks

Lenti ORF clone of Human ATG12 autophagy related 12 homolog (S. cerevisiae) (ATG12), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Apg12 (ATG12) (NM_004707) Human Tagged ORF Clone Lentiviral Particle
RC202012L4V

USD 820.00

7 Weeks

Lenti ORF particles, ATG12 (mGFP-tagged) - Human ATG12 autophagy related 12 homolog (S. cerevisiae) (ATG12), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Apg12 (ATG12) (NM_001277783) Human Tagged ORF Clone
RC235466

USD 420.00

2 Weeks

ATG12 (myc-DDK-tagged) - Human autophagy related 12 (ATG12), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ATG12
AB0083-200

USD 320.00

In Stock

Goat Polyclonal Anti-ATG12 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide within residues 65 aa to the N-terminus of human ATG12 produced in E. coli.
Apg12 (ATG12) (NM_004707) Human Tagged ORF Clone
RC202012L1

USD 768.00

In Stock

Lenti ORF clone of Human ATG12 autophagy related 12 homolog (S. cerevisiae) (ATG12), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Apg12 (ATG12) (NM_004707) Human Untagged Clone
SC117215

USD 310.00

In Stock

ATG12 (untagged)-Human ATG12 autophagy related 12 homolog (S. cerevisiae) (ATG12), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Apg12 (ATG12) (NM_004707) Human Tagged ORF Clone
RC202012L2

USD 620.00

3 Weeks

Lenti ORF clone of Human ATG12 autophagy related 12 homolog (S. cerevisiae) (ATG12), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Apg12 (ATG12) Rabbit Polyclonal Antibody
TA306511

USD 430.00

5 Days

Rabbit Polyclonal ATG12 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ATG12 antibody was raised against a 16 amino acid peptide from near the amino terminus of human ATG12.
Apg12 (ATG12) Rabbit Polyclonal Antibody
TA306512

USD 430.00

5 Days

Rabbit Polyclonal ATG12 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ATG12 antibody was raised against a 15 amino acid peptide from near the center of human ATG12.
Apg12 (ATG12) (NM_004707) Human Over-expression Lysate
LC401486

USD 121.00

In Stock

ATG12 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Apg12 (ATG12) (BC012266) Human Untagged Clone
SC106354

USD 310.00

In Stock

ATG12 (untagged)-Homo sapiens, Similar to Apg12 (autophagy 12, S. cerevisiae)-like, clone MGC:9094 IMAGE:3864058, complete cds

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Apg12 (ATG12) (NM_004707) Human Over-expression Lysate
LY401486

USD 396.00

5 Days

Transient overexpression lysate of ATG12 autophagy related 12 homolog (S. cerevisiae) (ATG12)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Apg12 (ATG12) Rabbit Polyclonal Antibody
TA335737

USD 375.00

5 Days

Rabbit Polyclonal Anti-ATG12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ATG12 Antibody: synthetic peptide directed towards the middle region of human ATG12. Synthetic peptide located within the following region: KFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAW
Apg12 (ATG12) (NM_001277783) Human Tagged ORF Clone
RG235466

USD 460.00

2 Weeks

ATG12 (GFP-tagged) - Human autophagy related 12 (ATG12), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Apg12 (ATG12) (NM_001277783) Human Untagged Clone
SC333360

USD 310.00

2 Weeks

ATG12 (untagged) - Human autophagy related 12 (ATG12), transcript variant 5

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Apg12 (ATG12) Rabbit Polyclonal Antibody
TA349483

USD 345.00

In Stock

Rabbit Polyclonal Anti-ATG12 Antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ATG12
Apg12 (ATG12) (NM_004707) ICC Control Block
TB402012

USD 1,040.00

4 Weeks

Transient overexpression of ATG12 (NM_004707) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Apg12 (ATG12) (NM_001277783) ICC Control Block
TB435466

USD 1,070.00

4 Weeks

Transient overexpression of ATG12 (NM_001277783) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Apg12 (ATG12) Cytosection
TS402012

USD 225.00

4 Weeks

Transient overexpression of ATG12 (NM_004707) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Apg12 (ATG12) Cytosection
TS402012P5

USD 889.00

4 Weeks

Transient overexpression of ATG12 (NM_004707) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Apg12 (ATG12) ICC Control Sections
TS435466P5

USD 889.00

4 Weeks

Transient overexpression of ATG12 (NM_001277783) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack