ATG12 (Myc-DDK-tagged)-Human ATG12 autophagy related 12 homolog (S. cerevisiae) (ATG12), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ATG12 (Myc-DDK-tagged)-Human ATG12 autophagy related 12 homolog (S. cerevisiae) (ATG12), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, ATG12 (Myc-DDK tagged) - Human ATG12 autophagy related 12 homolog (S. cerevisiae) (ATG12), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, ATG12 (mGFP-tagged) - Human ATG12 autophagy related 12 homolog (S. cerevisiae) (ATG12), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
ATG12 (GFP-tagged) - Human ATG12 autophagy related 12 homolog (S. cerevisiae) (ATG12), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human ATG12 autophagy related 12 homolog (S. cerevisiae) (ATG12), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ATG12 (Myc-DDK tagged) - Human ATG12 autophagy related 12 homolog (S. cerevisiae) (ATG12), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ATG12 autophagy related 12 homolog (S. cerevisiae) (ATG12), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ATG12 (mGFP-tagged) - Human ATG12 autophagy related 12 homolog (S. cerevisiae) (ATG12), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ATG12 (myc-DDK-tagged) - Human autophagy related 12 (ATG12), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Goat Polyclonal Anti-ATG12 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide within residues 65 aa to the N-terminus of human ATG12 produced in E. coli. |
Lenti ORF clone of Human ATG12 autophagy related 12 homolog (S. cerevisiae) (ATG12), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
ATG12 (untagged)-Human ATG12 autophagy related 12 homolog (S. cerevisiae) (ATG12), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human ATG12 autophagy related 12 homolog (S. cerevisiae) (ATG12), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal ATG12 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ATG12 antibody was raised against a 16 amino acid peptide from near the amino terminus of human ATG12. |
Rabbit Polyclonal ATG12 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ATG12 antibody was raised against a 15 amino acid peptide from near the center of human ATG12. |
ATG12 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
ATG12 (untagged)-Homo sapiens, Similar to Apg12 (autophagy 12, S. cerevisiae)-like, clone MGC:9094 IMAGE:3864058, complete cds
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Transient overexpression lysate of ATG12 autophagy related 12 homolog (S. cerevisiae) (ATG12)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-ATG12 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ATG12 Antibody: synthetic peptide directed towards the middle region of human ATG12. Synthetic peptide located within the following region: KFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAW |
ATG12 (GFP-tagged) - Human autophagy related 12 (ATG12), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ATG12 (untagged) - Human autophagy related 12 (ATG12), transcript variant 5
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-ATG12 Antibody
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ATG12 |
Transient overexpression of ATG12 (NM_004707) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ATG12 (NM_001277783) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ATG12 (NM_004707) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ATG12 (NM_004707) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ATG12 (NM_001277783) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack