Products

cDNA Clones (12)
Proteins (8)
Antibodies (5)
Jump to Filters
View as table Download
RPL5 (NM_000969) Human Tagged ORF Clone
RC210734

USD 420.00

In Stock

RPL5 (Myc-DDK-tagged)-Human ribosomal protein L5 (RPL5)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
RPL5 (NM_000969) Human Tagged ORF Clone
RG210734

USD 460.00

In Stock

RPL5 (GFP-tagged) - Human ribosomal protein L5 (RPL5)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RPL5 (NM_000969) Human Tagged ORF Clone
RC210734L3

USD 620.00

3 Weeks

Lenti ORF clone of Human ribosomal protein L5 (RPL5), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RPL5 (NM_000969) Human Tagged ORF Clone
RC210734L4

USD 620.00

3 Weeks

Lenti ORF clone of Human ribosomal protein L5 (RPL5), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RPL5 (NM_000969) Human Tagged ORF Clone
RC210734L1

USD 768.00

In Stock

Lenti ORF clone of Human ribosomal protein L5 (RPL5), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
RPL5 Rabbit Polyclonal Antibody
TA332482

USD 275.00

3 Weeks

Rabbit anti-RPL5 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RPL5
RPL5 (NM_000969) Human Over-expression Lysate
LY400352

USD 396.00

In Stock

Transient overexpression lysate of ribosomal protein L5 (RPL5)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
RPL5 (NM_000969) Human Tagged ORF Clone
RC210734L2

USD 620.00

3 Weeks

Lenti ORF clone of Human ribosomal protein L5 (RPL5), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
RPL5 Rabbit Polyclonal Antibody
TA314454

USD 345.00

In Stock

Rabbit polyclonal anti-RPL5 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPL5.
RPL5 (N-term) Rabbit Polyclonal Antibody
AP53722PU-N

USD 450.00

2 Weeks

RPL5 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 2~31 amino acids from the N-terminal region of Human RPL5.
RPL5 (NM_000969) Human Over-expression Lysate
LC400352

USD 121.00

In Stock

RPL5 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
RPL5 (NM_000969) Human Untagged Clone
SC119571

USD 660.00

In Stock

RPL5 (untagged)-Human ribosomal protein L5 (RPL5)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
RPL5 (NM_000969) Human Untagged Clone
SC322784

USD 660.00

In Stock

RPL5 (untagged)-Human ribosomal protein L5 (RPL5)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
RPL5 Rabbit Polyclonal Antibody
TA335158

USD 375.00

5 Days

Rabbit polyclonal Anti-Rpl5 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Rpl5 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEVHRKHIMG
RPL5 (NM_000969) Human Recombinant Protein
TP761599

USD 215.00

In Stock

Purified recombinant protein of Human ribosomal protein L5 (RPL5), full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug

Tag N-GST and C-His
Expression Host E. coli
RPL5 Rabbit Polyclonal Antibody
TA335157

USD 375.00

5 Days

Rabbit polyclonal Anti-RPL5 Antibody

Applications WB
Reactivities Arabidopsis thaliana, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPL5 antibody: synthetic peptide directed towards the N terminal of human RPL5. Synthetic peptide located within the following region: RLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELP
RPL5 (1-297, His-tag) Human Protein
AR51601PU-N

USD 1,105.00

2 Weeks

RPL5 (1-297, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
RPL5 (1-297, His-tag) Human Protein
AR51601PU-S

USD 415.00

2 Weeks

RPL5 (1-297, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
RPL5 ICC Control Block
TB410734

USD 1,070.00

4 Weeks

Transient overexpression of RPL5 (NM_000969) in HEK293T cells paraffin embedded controls for ICC/IHC staining

RPL5 Cytosection
TS410734

USD 225.00

4 Weeks

Transient overexpression of RPL5 (NM_000969) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

RPL5 Cytosection
TS410734P5

USD 889.00

4 Weeks

Transient overexpression of RPL5 (NM_000969) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack