Germany
Japan
United Kingdom
China
PIK3CB (Myc-DDK-tagged)-Human phosphoinositide-3-kinase, catalytic, beta polypeptide (PIK3CB)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadLenti ORF particles, PIK3CB (Myc-DDK tagged) - Human phosphoinositide-3-kinase, catalytic, beta polypeptide (PIK3CB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, PIK3CB (mGFP-tagged) - Human phosphoinositide-3-kinase, catalytic, beta polypeptide (PIK3CB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF clone of Human phosphoinositide-3-kinase, catalytic, beta polypeptide (PIK3CB), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PIK3CB (Myc-DDK tagged) - Human phosphoinositide-3-kinase, catalytic, beta polypeptide (PIK3CB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human phosphoinositide-3-kinase, catalytic, beta polypeptide (PIK3CB), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PIK3CB (mGFP-tagged) - Human phosphoinositide-3-kinase, catalytic, beta polypeptide (PIK3CB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PIK3CB (Myc-DDK tagged) - Homo sapiens phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit beta (PIK3CB), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PIK3CB (GFP-tagged) - Human phosphoinositide-3-kinase, catalytic, beta polypeptide (PIK3CB)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PIK3CB (GFP-tagged) - Homo sapiens phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit beta (PIK3CB), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human phosphoinositide-3-kinase, catalytic, beta polypeptide (PIK3CB), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
PIK3CB (untagged)-Human phosphoinositide-3-kinase, catalytic, beta polypeptide (PIK3CB)
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human phosphoinositide-3-kinase, catalytic, beta polypeptide (PIK3CB), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal antibody to PI3 kinase p110 beta (phosphoinositide-3-kinase, catalytic, beta polypeptide)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 509 and 820 of PI3 kinase p110 beta (Uniprot ID#P42338) |
Rabbit Polyclonal Anti-PIK3CB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIK3CB antibody: synthetic peptide directed towards the C terminal of human PIK3CB. Synthetic peptide located within the following region: VKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKD |
Rabbit Polyclonal Anti-PIK3CB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PIK3CB antibody is: synthetic peptide directed towards the N-terminal region of Human PIK3CB. Synthetic peptide located within the following region: ENATALHVKFPENKKQPYYYPPFDKSRGGKKFLPVLKEILDRDPLSQLCE |
PIK3CB (untagged) - Homo sapiens phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit beta (PIK3CB), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
Transient overexpression of PIK3CB (NM_006219) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PIK3CB (NM_001256045) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human phosphoinositide-3-kinase, catalytic, beta polypeptide (PIK3CB), Cys287-Lys575, with N-terminal His tag, expressed in E.coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Transient overexpression of PIK3CB (NM_006219) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PIK3CB (NM_006219) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PIK3CB (NM_001256045) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PIK3CB
Pathways
- Small cell lung cancer