Germany
Japan
United Kingdom
China
PIK3CB (Myc-DDK-tagged)-Human phosphoinositide-3-kinase, catalytic, beta polypeptide (PIK3CB)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadPik3cb (Myc-DDK-tagged) - Mouse phosphatidylinositol 3-kinase, catalytic, beta polypeptide (Pik3cb)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, PIK3CB (Myc-DDK tagged) - Human phosphoinositide-3-kinase, catalytic, beta polypeptide (PIK3CB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, PIK3CB (mGFP-tagged) - Human phosphoinositide-3-kinase, catalytic, beta polypeptide (PIK3CB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
PIK3CB - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN415433 is the updated version of KN215433.
Pik3cb - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN513295 is the updated version of KN313295.
Pik3cb (GFP-tagged) - Mouse phosphatidylinositol 3-kinase catalytic beta polypeptide (Pik3cb), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Pik3cb (Myc-DDK-tagged) - Mouse phosphatidylinositol 3-kinase, catalytic, beta polypeptide (Pik3cb)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pik3cb (Myc-DDK-tagged) - Mouse phosphatidylinositol 3-kinase, catalytic, beta polypeptide (Pik3cb), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Pik3cb (mGFP-tagged) - Mouse phosphatidylinositol 3-kinase, catalytic, beta polypeptide (Pik3cb)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pik3cb (GFP-tagged) - Mouse phosphatidylinositol 3-kinase, catalytic, beta polypeptide (Pik3cb), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human phosphoinositide-3-kinase, catalytic, beta polypeptide (PIK3CB), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PIK3CB (Myc-DDK tagged) - Human phosphoinositide-3-kinase, catalytic, beta polypeptide (PIK3CB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human phosphoinositide-3-kinase, catalytic, beta polypeptide (PIK3CB), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PIK3CB (mGFP-tagged) - Human phosphoinositide-3-kinase, catalytic, beta polypeptide (PIK3CB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PIK3CB (Myc-DDK tagged) - Homo sapiens phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit beta (PIK3CB), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PIK3CB (GFP-tagged) - Human phosphoinositide-3-kinase, catalytic, beta polypeptide (PIK3CB)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PIK3CB (GFP-tagged) - Homo sapiens phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit beta (PIK3CB), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Pik3cb (Myc-DDK-tagged ORF) - Rat phosphoinositide-3-kinase, catalytic, beta polypeptide (Pik3cb), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Pik3cb (Myc-DDK-tagged ORF) - Rat phosphoinositide-3-kinase, catalytic, beta polypeptide (Pik3cb), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pik3cb (Myc-DDK-tagged ORF) - Rat phosphoinositide-3-kinase, catalytic, beta polypeptide (Pik3cb), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Pik3cb (mGFP-tagged ORF) - Rat phosphoinositide-3-kinase, catalytic, beta polypeptide (Pik3cb), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pik3cb (GFP-tagged ORF) - Rat phosphoinositide-3-kinase, catalytic, beta polypeptide (Pik3cb), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PIK3CB - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human phosphoinositide-3-kinase, catalytic, beta polypeptide (PIK3CB), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
PIK3CB (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
qSTAR qPCR primer pairs against Homo sapiens gene PIK3CB
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
PIK3CB (untagged)-Human phosphoinositide-3-kinase, catalytic, beta polypeptide (PIK3CB)
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
qSTAR qPCR primer pairs against Mus musculus gene Pik3cb
Lenti ORF clone of Human phosphoinositide-3-kinase, catalytic, beta polypeptide (PIK3CB), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Pik3cb (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Rabbit Polyclonal antibody to PI3 kinase p110 beta (phosphoinositide-3-kinase, catalytic, beta polypeptide)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 509 and 820 of PI3 kinase p110 beta (Uniprot ID#P42338) |
Pik3cb - Rat, 4 unique 29mer shRNA constructs in retroviral RFP vector
| Format | Retroviral plasmids |
| Vector | pRFP-C-RS |
Pik3cb - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
PIK3CB - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | GFP-puro |
Rabbit Polyclonal Anti-PIK3CB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIK3CB antibody: synthetic peptide directed towards the C terminal of human PIK3CB. Synthetic peptide located within the following region: VKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKD |
Rabbit Polyclonal Anti-PIK3CB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PIK3CB antibody is: synthetic peptide directed towards the N-terminal region of Human PIK3CB. Synthetic peptide located within the following region: ENATALHVKFPENKKQPYYYPPFDKSRGGKKFLPVLKEILDRDPLSQLCE |
PIK3CB - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector
| Format | Retroviral plasmids |
| Vector | pRFP-C-RS |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
PIK3CB - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Pik3cb - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
PIK3CB CRISPRa kit - CRISPR gene activation of human phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Pik3cb CRISPRa kit - CRISPR gene activation of mouse phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
PIK3CB - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | mBFP-Neo |
PIK3CB - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | Luciferase-Puro |
PIK3CB - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | RFP-BSD |
Pik3cb (untagged) - Mouse phosphatidylinositol 3-kinase, catalytic, beta polypeptide (Pik3cb), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Pik3cb (untagged ORF) - Rat phosphoinositide-3-kinase, catalytic, beta polypeptide (Pik3cb), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PIK3CB (untagged) - Homo sapiens phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit beta (PIK3CB), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
Pik3cb (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Active filters
Target Symbol
- PIK3CB
Filter by
Species
Antibody Hosts
Isotypes
Clonalities
Conjugates
Expression Hosts
Lentivirus
Vectors
Modifications
Mutants
Mammalian Cell Selection
Families
Pathways
- Acute myeloid leukemia (24)
- Apoptosis (24)
- B cell receptor signaling pathway (24)
- Chemokine signaling pathway (24)
- Chronic myeloid leukemia (24)
- Colorectal cancer (24)
- Endometrial cancer (24)
- ErbB signaling pathway (24)
- Fc epsilon RI signaling pathway (24)
- Fc gamma R-mediated phagocytosis (24)
- Focal adhesion (24)
- Glioma (24)
- Inositol phosphate metabolism (24)
- Insulin signaling pathway (24)
- Jak-STAT signaling pathway (24)
- Leukocyte transendothelial migration (24)
- Melanoma (24)
- Natural killer cell mediated cytotoxicity (24)
- Neurotrophin signaling pathway (24)
- Non-small cell lung cancer (24)
- Pancreatic cancer (24)
- Pathways in cancer (24)
- Phosphatidylinositol signaling system (24)
- Progesterone-mediated oocyte maturation (24)
- Prostate cancer (24)
- Regulation of actin cytoskeleton (24)
- Renal cell carcinoma (24)
- Small cell lung cancer (24)
- T cell receptor signaling pathway (24)
- Toll-like receptor signaling pathway (24)
- Type II diabetes mellitus (24)
- VEGF signaling pathway (24)
- mTOR signaling pathway (24)