Products

cDNA Clones (17)
Proteins (12)
Antibodies (2)
Jump to Filters
View as table Download
Heterogeneous Nuclear Ribonucleoprotein (A1 like) (HNRNPA1L2) (NM_001011724) Human Tagged ORF Clone
RC218191

USD 420.00

In Stock

HNRNPA1L2 (Myc-DDK-tagged)-Human heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Heterogeneous Nuclear Ribonucleoprotein (A1 like) (HNRNPA1L2) (NM_001011725) Human Tagged ORF Clone
RC223427

USD 420.00

In Stock

HNRNPA1L2 (Myc-DDK-tagged)-Human heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Heterogeneous Nuclear Ribonucleoprotein (A1 like) (HNRNPA1L2) (NM_001011724) Human Tagged ORF Clone Lentiviral Particle
RC218191L1V

USD 820.00

3 Weeks

Lenti ORF particles, HNRNPA1L2 (Myc-DDK tagged) - Human heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
Heterogeneous Nuclear Ribonucleoprotein (A1 like) (HNRNPA1L2) (NM_001011724) Human Tagged ORF Clone Lentiviral Particle
RC218191L2V

USD 820.00

6 Weeks

Lenti ORF particles, HNRNPA1L2 (mGFP-tagged) - Human heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Heterogeneous Nuclear Ribonucleoprotein (A1 like) (HNRNPA1L2) (NM_001011724) Human Tagged ORF Clone
RG218191

USD 460.00

In Stock

HNRNPA1L2 (GFP-tagged) - Human heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Heterogeneous Nuclear Ribonucleoprotein (A1 like) (HNRNPA1L2) (NM_001011724) Human Tagged ORF Clone
RC218191L3

USD 620.00

3 Weeks

Lenti ORF clone of Human heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Heterogeneous Nuclear Ribonucleoprotein (A1 like) (HNRNPA1L2) (NM_001011724) Human Tagged ORF Clone Lentiviral Particle
RC218191L3V

USD 820.00

5 Weeks

Lenti ORF particles, HNRNPA1L2 (Myc-DDK tagged) - Human heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Heterogeneous Nuclear Ribonucleoprotein (A1 like) (HNRNPA1L2) (NM_001011724) Human Tagged ORF Clone
RC218191L4

USD 620.00

3 Weeks

Lenti ORF clone of Human heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Heterogeneous Nuclear Ribonucleoprotein (A1 like) (HNRNPA1L2) (NM_001011724) Human Tagged ORF Clone Lentiviral Particle
RC218191L4V

USD 820.00

7 Weeks

Lenti ORF particles, HNRNPA1L2 (mGFP-tagged) - Human heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Heterogeneous Nuclear Ribonucleoprotein (A1 like) (HNRNPA1L2) (NM_001011725) Human Tagged ORF Clone
RC223427L3

USD 620.00

3 Weeks

Lenti ORF clone of Human heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Heterogeneous Nuclear Ribonucleoprotein (A1 like) (HNRNPA1L2) (NM_001011725) Human Tagged ORF Clone Lentiviral Particle
RC223427L3V

USD 820.00

6 Weeks

Lenti ORF particles, HNRNPA1L2 (Myc-DDK tagged) - Human heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Heterogeneous Nuclear Ribonucleoprotein (A1 like) (HNRNPA1L2) (NM_001011725) Human Tagged ORF Clone
RC223427L4

USD 620.00

3 Weeks

Lenti ORF clone of Human heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Heterogeneous Nuclear Ribonucleoprotein (A1 like) (HNRNPA1L2) (NM_001011725) Human Tagged ORF Clone Lentiviral Particle
RC223427L4V

USD 820.00

6 Weeks

Lenti ORF particles, HNRNPA1L2 (mGFP-tagged) - Human heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Heterogeneous Nuclear Ribonucleoprotein (A1 like) (HNRNPA1L2) Rabbit Polyclonal Antibody
TA345729

USD 410.00

5 Days

Rabbit Polyclonal Anti-RP11-78J21.1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RP11-78J21.1 antibody: synthetic peptide directed towards the N terminal of human RP11-78J21.1. Synthetic peptide located within the following region: MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN
Heterogeneous Nuclear Ribonucleoprotein (A1 like) (HNRNPA1L2) Rabbit Polyclonal Antibody
TA345730

USD 475.00

5 Days

Rabbit Polyclonal Anti-RP11-78J21.1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RP11-78J21.1 antibody: synthetic peptide directed towards the N terminal of human RP11-78J21.1. Synthetic peptide located within the following region: MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN
Heterogeneous Nuclear Ribonucleoprotein (A1 like) (HNRNPA1L2) (NM_001011724) Human Tagged ORF Clone
RC218191L2

USD 620.00

3 Weeks

Lenti ORF clone of Human heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Heterogeneous Nuclear Ribonucleoprotein (A1 like) (HNRNPA1L2) (NM_001011724) Human Over-expression Lysate
LY423305

USD 396.00

5 Days

Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Heterogeneous Nuclear Ribonucleoprotein (A1 like) (HNRNPA1L2) (NM_001011725) Human Over-expression Lysate
LY423306

USD 396.00

5 Days

Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Heterogeneous Nuclear Ribonucleoprotein (A1 like) (HNRNPA1L2) Cytosection
TS418191

USD 225.00

4 Weeks

Transient overexpression of HNRNPA1L2 (NM_001011724) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Heterogeneous Nuclear Ribonucleoprotein (A1 like) (HNRNPA1L2) Cytosection
TS418191P5

USD 889.00

4 Weeks

Transient overexpression of HNRNPA1L2 (NM_001011724) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Heterogeneous Nuclear Ribonucleoprotein (A1 like) (HNRNPA1L2) Cytosection
TS423427

USD 225.00

4 Weeks

Transient overexpression of HNRNPA1L2 (NM_001011725) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Heterogeneous Nuclear Ribonucleoprotein (A1 like) (HNRNPA1L2) Cytosection
TS423427P5

USD 889.00

4 Weeks

Transient overexpression of HNRNPA1L2 (NM_001011725) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack