Germany
Japan
United Kingdom
China
USD 420.00
In Stock
HNRNPA1L2 (Myc-DDK-tagged)-Human heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
USD 420.00
In Stock
HNRNPA1L2 (Myc-DDK-tagged)-Human heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, HNRNPA1L2 (Myc-DDK tagged) - Human heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, HNRNPA1L2 (mGFP-tagged) - Human heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
USD 460.00
In Stock
HNRNPA1L2 (GFP-tagged) - Human heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 1,290.00
2 Weeks
HNRNPA1L2 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN418191 is the updated version of KN218191.
USD 620.00
3 Weeks
Lenti ORF clone of Human heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, HNRNPA1L2 (Myc-DDK tagged) - Human heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 620.00
3 Weeks
Lenti ORF clone of Human heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
7 Weeks
Lenti ORF particles, HNRNPA1L2 (mGFP-tagged) - Human heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 620.00
3 Weeks
Lenti ORF clone of Human heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, HNRNPA1L2 (Myc-DDK tagged) - Human heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 620.00
3 Weeks
Lenti ORF clone of Human heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, HNRNPA1L2 (mGFP-tagged) - Human heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 460.00
3 Weeks
HNRNPA1L2 (GFP-tagged) - Human heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 380.00
4 Weeks
USD 410.00
5 Days
Rabbit Polyclonal Anti-RP11-78J21.1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RP11-78J21.1 antibody: synthetic peptide directed towards the N terminal of human RP11-78J21.1. Synthetic peptide located within the following region: MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN |
USD 475.00
5 Days
Rabbit Polyclonal Anti-RP11-78J21.1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RP11-78J21.1 antibody: synthetic peptide directed towards the N terminal of human RP11-78J21.1. Synthetic peptide located within the following region: MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN |
USD 620.00
3 Weeks
Lenti ORF clone of Human heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
USD 660.00
In Stock
HNRNPA1L2 (untagged)-Human heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
USD 1,290.00
2 Weeks
HNRNPA1L2 CRISPRa kit - CRISPR gene activation of human heterogeneous nuclear ribonucleoprotein A1 like 2
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
USD 120.00
5 Days
qSTAR qPCR primer pairs against Homo sapiens gene HNRNPA1L2
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
USD 121.00
2 Weeks
HNRNPA1L2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
USD 121.00
2 Weeks
HNRNPA1L2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
USD 396.00
5 Days
Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
USD 396.00
5 Days
Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
USD 2,055.00
3 Weeks
HNRNPA1L2 MS Standard C13 and N15-labeled recombinant protein (NP_001011724)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
USD 2,055.00
3 Weeks
HNRNPA1L2 MS Standard C13 and N15-labeled recombinant protein (NP_001011725)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
USD 560.00
4 Weeks
3`UTR clone of heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2) transcript variant 2 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
USD 560.00
4 Weeks
3`UTR clone of heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2) transcript variant 1 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
USD 660.00
3 Weeks
HNRNPA1L2 (untagged)-Human heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
HNRNPA1L2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human HNRNPA1L2 |
USD 380.00
4 Weeks
HNRNPA1L2 Rabbit monoclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 1,070.00
4 Weeks
Transient overexpression of HNRNPA1L2 (NM_001011724) in HEK293T cells paraffin embedded controls for ICC/IHC staining
USD 1,070.00
4 Weeks
Transient overexpression of HNRNPA1L2 (NM_001011725) in HEK293T cells paraffin embedded controls for ICC/IHC staining
USD 815.00
2 Weeks
HNRNPA1L2 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
USD 1,395.00
5 Weeks
HNRNPA1L2 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
USD 715.00
2 Weeks
HNRNPA1L2 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
USD 225.00
4 Weeks
Transient overexpression of HNRNPA1L2 (NM_001011724) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
USD 889.00
4 Weeks
Transient overexpression of HNRNPA1L2 (NM_001011724) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
USD 225.00
4 Weeks
Transient overexpression of HNRNPA1L2 (NM_001011725) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
USD 889.00
4 Weeks
Transient overexpression of HNRNPA1L2 (NM_001011725) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- HNRNPA1L2