SNRPB (Myc-DDK-tagged)-Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SNRPB (Myc-DDK-tagged)-Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SNRPB (Myc-DDK-tagged)-Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, SNRPB (Myc-DDK tagged) - Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, SNRPB (mGFP-tagged) - Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
SNRPB (GFP-tagged) - Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, SNRPB (Myc-DDK tagged) - Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SNRPB (mGFP-tagged) - Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SNRPB (Myc-DDK tagged) - Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SNRPB (mGFP-tagged) - Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
SNRPB (GFP-tagged) - Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-SNRPB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SNRPB antibody: synthetic peptide directed towards the middle region of human SNRPB. Synthetic peptide located within the following region: LRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMP |
Rabbit Polyclonal Anti-SNRPB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SNRPB antibody: synthetic peptide directed towards the N terminal of human SNRPB. Synthetic peptide located within the following region: DKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEG |
Lenti ORF clone of Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
SNRPB (untagged)-Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
SNRPB (N-term) rabbit polyclonal antibody
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 42~72 amino acids from the N-terminal region of Human SNRPB |
SNRPB (untagged)-Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Purified recombinant protein of Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 2, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug
Tag | N-GST and C-His |
Expression Host | E. coli |
SNRPB MS Standard C13 and N15-labeled recombinant protein (NP_937859)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
SNRPB HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
SNRPB HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
SNRPB HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression of SNRPB (NM_003091) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SNRPB (NM_198216) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SNRPB (NM_003091) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SNRPB (NM_003091) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of SNRPB (NM_198216) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SNRPB (NM_198216) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack