Products

View as table Download

USD 98.00

USD 390.00

In Stock

SNRPB (Myc-DDK-tagged)-Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

SNRPB (Myc-DDK-tagged)-Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, SNRPB (Myc-DDK tagged) - Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, SNRPB (mGFP-tagged) - Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

SNRPB (GFP-tagged) - Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, SNRPB (Myc-DDK tagged) - Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, SNRPB (mGFP-tagged) - Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, SNRPB (Myc-DDK tagged) - Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, SNRPB (mGFP-tagged) - Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

SNRPB (GFP-tagged) - Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit Polyclonal Anti-SNRPB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SNRPB antibody: synthetic peptide directed towards the middle region of human SNRPB. Synthetic peptide located within the following region: LRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMP

Rabbit Polyclonal Anti-SNRPB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SNRPB antibody: synthetic peptide directed towards the N terminal of human SNRPB. Synthetic peptide located within the following region: DKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEG

Lenti ORF clone of Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

SNRPB (untagged)-Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

SNRPB (N-term) rabbit polyclonal antibody

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 42~72 amino acids from the N-terminal region of Human SNRPB

SNRPB (untagged)-Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Purified recombinant protein of Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 2, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug

Tag N-GST and C-His
Expression Host E. coli

SNRPB MS Standard C13 and N15-labeled recombinant protein (NP_937859)

Tag C-Myc/DDK
Expression Host HEK293

SNRPB HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

SNRPB HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

SNRPB HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

LY404878 is the same product as LY430722.

USD 1,040.00

4 Weeks

Transient overexpression of SNRPB (NM_003091) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,070.00

4 Weeks

Transient overexpression of SNRPB (NM_198216) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of SNRPB (NM_003091) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of SNRPB (NM_003091) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of SNRPB (NM_198216) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of SNRPB (NM_198216) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack