Products

cDNA Clones (21)
Antibodies (12)
Proteins (7)
Jump to Filters
View as table Download
p107 (RBL1) (NM_183404) Human Tagged ORF Clone
RC207017

USD 1,060.00

In Stock

RBL1 (Myc-DDK-tagged)-Human retinoblastoma-like 1 (p107) (RBL1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
p107 (RBL1) (NM_183404) Human Tagged ORF Clone Lentiviral Particle
RC207017L2V

USD 1,460.00

6 Weeks

Lenti ORF particles, RBL1 (mGFP-tagged) - Human retinoblastoma-like 1 (p107) (RBL1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
p107 (RBL1) (NM_002895) Human Tagged ORF Clone Lentiviral Particle
RC215873L2V

USD 1,520.00

3 Weeks

Lenti ORF particles, RBL1 (mGFP-tagged)-Human retinoblastoma-like 1 (p107) (RBL1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
p107 (RBL1) (NM_183404) Human Tagged ORF Clone
RG207017

USD 1,170.00

In Stock

RBL1 (GFP-tagged) - Human retinoblastoma-like 1 (p107) (RBL1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
p107 (RBL1) (NM_002895) Human Tagged ORF Clone
RG215873

USD 1,230.00

In Stock

RBL1 (GFP-tagged) - Human retinoblastoma-like 1 (p107) (RBL1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
p107 (RBL1) (NM_183404) Human Tagged ORF Clone
RC207017L3

USD 1,260.00

3 Weeks

Lenti ORF clone of Human retinoblastoma-like 1 (p107) (RBL1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
p107 (RBL1) (NM_183404) Human Tagged ORF Clone Lentiviral Particle
RC207017L3V

USD 1,460.00

5 Weeks

Lenti ORF particles, RBL1 (Myc-DDK tagged) - Human retinoblastoma-like 1 (p107) (RBL1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
p107 (RBL1) (NM_183404) Human Tagged ORF Clone
RC207017L4

USD 1,260.00

3 Weeks

Lenti ORF clone of Human retinoblastoma-like 1 (p107) (RBL1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
p107 (RBL1) (NM_183404) Human Tagged ORF Clone Lentiviral Particle
RC207017L4V

USD 1,460.00

7 Weeks

Lenti ORF particles, RBL1 (mGFP-tagged) - Human retinoblastoma-like 1 (p107) (RBL1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
p107 (RBL1) (NM_002895) Human Tagged ORF Clone
RC215873

USD 1,120.00

3 Weeks

RBL1 (Myc-DDK-tagged)-Human retinoblastoma-like 1 (p107) (RBL1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
p107 (RBL1) (NM_002895) Human Tagged ORF Clone
RC215873L3

USD 1,320.00

3 Weeks

Lenti-ORF clone of RBL1 (Myc-DDK-tagged)-Human retinoblastoma-like 1 (p107) (RBL1), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
p107 (RBL1) (NM_002895) Human Tagged ORF Clone Lentiviral Particle
RC215873L3V

USD 1,520.00

11 Weeks

Lenti ORF particles, RBL1 (Myc-DDK-tagged)-Human retinoblastoma-like 1 (p107) (RBL1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
p107 (RBL1) (NM_002895) Human Tagged ORF Clone
RC215873L4

USD 1,320.00

3 Weeks

Lenti-ORF clone of RBL1 (mGFP-tagged)-Human retinoblastoma-like 1 (p107) (RBL1), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
p107 (RBL1) (NM_002895) Human Tagged ORF Clone Lentiviral Particle
RC215873L4V

USD 1,520.00

5 Weeks

Lenti ORF particles, RBL1 (mGFP-tagged)-Human retinoblastoma-like 1 (p107) (RBL1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
p107 (RBL1) (NM_183404) Human Untagged Clone
SC109715

USD 310.00

In Stock

RBL1 (untagged)-Human retinoblastoma-like 1 (p107) (RBL1), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
p107 (RBL1) (NM_183404) Human Tagged ORF Clone
RC207017L1

USD 1,560.00

In Stock

Lenti ORF clone of Human retinoblastoma-like 1 (p107) (RBL1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
p107 (RBL1) (NM_002895) Human Untagged Clone
SC109714

USD 2,160.00

In Stock

RBL1 (untagged)-Human retinoblastoma-like 1 (p107) (RBL1), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
p107 (RBL1) (NM_183404) Human Tagged ORF Clone
RC207017L2

USD 1,260.00

3 Weeks

Lenti ORF clone of Human retinoblastoma-like 1 (p107) (RBL1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
p107 (RBL1) (NM_002895) Human Tagged ORF Clone
RC215873L1

USD 1,320.00

3 Weeks

Lenti-ORF clone of RBL1 (Myc-DDK-tagged)-Human retinoblastoma-like 1 (p107) (RBL1), transcript variant 1

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
p107 (RBL1) (NM_183404) Human Over-expression Lysate
LY403655

USD 396.00

5 Days

Transient overexpression lysate of retinoblastoma-like 1 (p107) (RBL1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
p107 (RBL1) Rabbit Polyclonal Antibody
TA330042

USD 375.00

5 Days

Rabbit Polyclonal Anti-RBL1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-RBL1 antibody: synthetic peptide directed towards the N terminal of human RBL1. Synthetic peptide located within the following region: FLDIFQNPYEEPPKLPRSRKQRRIPCSVKDLFNFCWTLFVYTKGNFRMIG
p107 (RBL1) Rabbit Polyclonal Antibody
TA330570

USD 375.00

5 Days

Rabbit Polyclonal Anti-RBL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RBL1 antibody: synthetic peptide directed towards the middle region of human RBL1. Synthetic peptide located within the following region: NTIYVGRVKSFALKYDLANQDHMMDAPPLSPFPHIKQQPGSPRRISQQHS
p107 (RBL1) Mouse Monoclonal Antibody [Clone ID: OTI4E1]
CF811337

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RBL1 mouse monoclonal antibody,clone OTI4E1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
p107 (RBL1) Mouse Monoclonal Antibody [Clone ID: OTI4A10]
CF811375

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RBL1 mouse monoclonal antibody,clone OTI4A10

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
p107 (RBL1) (NM_183404) Human Over-expression Lysate
LC403655

USD 121.00

2 Weeks

RBL1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
p107 (RBL1) Mouse Monoclonal Antibody [Clone ID: OTI4E1]
TA811337

USD 379.00

In Stock

RBL1 mouse monoclonal antibody,clone OTI4E1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
p107 (RBL1) Mouse Monoclonal Antibody [Clone ID: OTI4E1]
TA811337S

USD 159.00

2 Days

RBL1 mouse monoclonal antibody,clone OTI4E1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
p107 (RBL1) Mouse Monoclonal Antibody [Clone ID: OTI4A10]
TA811375

USD 379.00

In Stock

RBL1 mouse monoclonal antibody,clone OTI4A10

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
p107 (RBL1) Mouse Monoclonal Antibody [Clone ID: OTI4A10]
TA811375S

USD 159.00

2 Days

RBL1 mouse monoclonal antibody,clone OTI4A10

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
p107 (RBL1) ICC Control Block
TB407017

USD 1,710.00

4 Weeks

Transient overexpression of RBL1 (NM_183404) in HEK293T cells paraffin embedded controls for ICC/IHC staining

p107 (RBL1) ICC Control Block
TB415873

USD 1,770.00

4 Weeks

Transient overexpression of RBL1 (NM_002895) in HEK293T cells paraffin embedded controls for ICC/IHC staining

p107 (RBL1) Cytosection
TS407017

USD 225.00

4 Weeks

Transient overexpression of RBL1 (NM_183404) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

p107 (RBL1) Cytosection
TS407017P5

USD 889.00

4 Weeks

Transient overexpression of RBL1 (NM_183404) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

p107 (RBL1) ICC Control Sections
TS415873P5

USD 889.00

4 Weeks

Transient overexpression of RBL1 (NM_002895) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack