MLLT4 (Myc-DDK-tagged)-Human myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila), translocated to, 4 (MLLT4), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
MLLT4 (Myc-DDK-tagged)-Human myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila), translocated to, 4 (MLLT4), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
MLLT4 (GFP-tagged) - Human myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 4 (MLLT4), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of MLLT4 (Myc-DDK-tagged)-Human myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 4 (MLLT4), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,670.00
6 Weeks
Lenti ORF particles, MLLT4 (Myc-DDK-tagged)-Human myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 4 (MLLT4), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of MLLT4 (mGFP-tagged)-Human myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 4 (MLLT4), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,670.00
6 Weeks
Lenti ORF particles, MLLT4 (mGFP-tagged)-Human myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 4 (MLLT4), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
MLLT4 (Myc-DDK tagged) - Homo sapiens myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila), translocated to, 4 (MLLT4), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
MLLT4 (myc-DDK-tagged) - Human myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila), translocated to, 4 (MLLT4), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
MLLT4 (GFP-tagged) - Homo sapiens myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 4 (MLLT4), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
MLLT4 (untagged)-Human myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila), translocated to, 4 (MLLT4), transcript variant 2
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
MLLT4 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 4 (MLLT4), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-MLLT4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MLLT4 Antibody: synthetic peptide directed towards the N terminal of human MLLT4. Synthetic peptide located within the following region: GVIQNFKRTLSKKEKKEKKKREKEALRQASDKDDRPFQGEDVENSRLAAE |
MLLT4 (GFP-tagged) - Human myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila), translocated to, 4 (MLLT4), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
MLLT4 (untagged) - Homo sapiens myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila), translocated to, 4 (MLLT4), transcript variant 1
Vector | pCMV6 series |
Tag | Tag Free |
MLLT4 (untagged) - Human myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila), translocated to, 4 (MLLT4), transcript variant 4
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of MLLT4 (NM_001040000) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MLLT4 (NM_001207008) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MLLT4 (NM_001291964) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MLLT4 (NM_001040000) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MLLT4 (NM_001040000) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of MLLT4 (NM_001207008) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of MLLT4 (NM_001291964) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack