Products

cDNA Clones (25)
Proteins (14)
Antibodies (4)
Jump to Filters
View as table Download
CLDN19 (NM_148960) Human Tagged ORF Clone
RC216887

USD 98.00

USD 390.00

In Stock

CLDN19 (Myc-DDK-tagged)-Human claudin 19 (CLDN19), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CLDN19 (NM_001123395) Human Tagged ORF Clone
RC225251

USD 420.00

In Stock

CLDN19 (Myc-DDK-tagged)-Human claudin 19 (CLDN19), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CLDN19 (NM_148960) Human Tagged ORF Clone Lentiviral Particle
RC216887L1V

USD 820.00

3 Weeks

Lenti ORF particles, CLDN19 (Myc-DDK tagged) - Human claudin 19 (CLDN19), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
CLDN19 (NM_148960) Human Tagged ORF Clone Lentiviral Particle
RC216887L2V

USD 820.00

6 Weeks

Lenti ORF particles, CLDN19 (mGFP-tagged) - Human claudin 19 (CLDN19), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
CLDN19 (NM_148960) Human Tagged ORF Clone
RG216887

USD 460.00

In Stock

CLDN19 (GFP-tagged) - Human claudin 19 (CLDN19), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CLDN19 (NM_148960) Human Tagged ORF Clone
RC216887L3

USD 620.00

3 Weeks

Lenti ORF clone of Human claudin 19 (CLDN19), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CLDN19 (NM_148960) Human Tagged ORF Clone Lentiviral Particle
RC216887L3V

USD 820.00

5 Weeks

Lenti ORF particles, CLDN19 (Myc-DDK tagged) - Human claudin 19 (CLDN19), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CLDN19 (NM_148960) Human Tagged ORF Clone
RC216887L4

USD 620.00

3 Weeks

Lenti ORF clone of Human claudin 19 (CLDN19), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CLDN19 (NM_148960) Human Tagged ORF Clone Lentiviral Particle
RC216887L4V

USD 820.00

7 Weeks

Lenti ORF particles, CLDN19 (mGFP-tagged) - Human claudin 19 (CLDN19), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CLDN19 (NM_001123395) Human Tagged ORF Clone
RC225251L3

USD 620.00

3 Weeks

Lenti ORF clone of Human claudin 19 (CLDN19), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CLDN19 (NM_001123395) Human Tagged ORF Clone
RC225251L4

USD 620.00

3 Weeks

Lenti ORF clone of Human claudin 19 (CLDN19), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CLDN19 (NM_001185117) Human Tagged ORF Clone
RC231064

USD 420.00

3 Weeks

CLDN19 (Myc-DDK-tagged)-Human claudin 19 (CLDN19), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CLDN19 (NM_001185117) Human Tagged ORF Clone
RC231064L3

USD 620.00

3 Weeks

Lenti-ORF clone of CLDN19 (Myc-DDK-tagged)-Human claudin 19 (CLDN19), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CLDN19 (NM_001185117) Human Tagged ORF Clone
RC231064L4

USD 620.00

3 Weeks

Lenti-ORF clone of CLDN19 (mGFP-tagged)-Human claudin 19 (CLDN19), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CLDN19 (NM_001123395) Human Tagged ORF Clone
RG225251

USD 460.00

3 Weeks

CLDN19 (GFP-tagged) - Human claudin 19 (CLDN19), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CLDN19 (NM_001185117) Human Tagged ORF Clone
RG231064

USD 460.00

4 Weeks

CLDN19 (GFP-tagged) - Human claudin 19 (CLDN19), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CLDN19 (NM_148960) Human Tagged ORF Clone
RC216887L1

USD 768.00

In Stock

Lenti ORF clone of Human claudin 19 (CLDN19), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CLDN19 (NM_148960) Human Over-expression Lysate
LY407723

USD 396.00

In Stock

Transient overexpression lysate of claudin 19 (CLDN19), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CLDN19 (BC030524) Human Untagged Clone
SC122459

USD 310.00

In Stock

CLDN19 (untagged)-Human claudin 19 (cDNA clone MGC:40523 IMAGE:5207628), complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CLDN19 (NM_148960) Human Tagged ORF Clone
RC216887L2

USD 620.00

3 Weeks

Lenti ORF clone of Human claudin 19 (CLDN19), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CLDN19 (NM_148960) Human Untagged Clone
SC306338

USD 420.00

In Stock

CLDN19 (untagged)-Human claudin 19 (CLDN19), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CLDN19 Rabbit Polyclonal Antibody
TA316160

USD 345.00

In Stock

Rabbit polyclonal anti-CLDN19 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CLDN19.
CLDN19 (NM_148960) Human Over-expression Lysate
LC407723

USD 121.00

In Stock

CLDN19 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CLDN19 (NM_001123395) Human Over-expression Lysate
LC426624

USD 121.00

In Stock

CLDN19 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CLDN19 (NM_001123395) Human Over-expression Lysate
LY426624

USD 396.00

In Stock

Transient overexpression lysate of claudin 19 (CLDN19), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CLDN19 Rabbit Polyclonal Antibody
TA334198

USD 375.00

5 Days

Rabbit Polyclonal Anti-CLDN19 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN19 antibody: synthetic peptide directed towards the C terminal of human CLDN19. Synthetic peptide located within the following region: AVLGGSFLCCTCPEPERPNSSPQPYRPGPSAAAREPVVKLPASAKGPLGV
CLDN19 (NM_148960) Human Mass Spec Standard
PH316887

USD 2,055.00

3 Weeks

CLDN19 MS Standard C13 and N15-labeled recombinant protein (NP_683763)

Tag C-Myc/DDK
Expression Host HEK293
CLDN19 (NM_001123395) Human Mass Spec Standard
PH325251

USD 2,055.00

3 Weeks

CLDN19 MS Standard C13 and N15-labeled recombinant protein (NP_001116867)

Tag C-Myc/DDK
Expression Host HEK293
CLDN19 (NM_001123395) Human Untagged Clone
SC322900

USD 420.00

3 Weeks

CLDN19 (untagged)-Human claudin 19 (CLDN19), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
CLDN19 Rabbit Polyclonal Antibody
TA322028

USD 345.00

In Stock

Anti-CLDN19 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 186-200 amino acids of Human Claudin 19
CLDN19 Rabbit Polyclonal Antibody
TA322029

USD 345.00

In Stock

Anti-CLDN19 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 186-200 amino acids of Human Claudin 19
CLDN19 (NM_148960) ICC Control Block
TB416887

USD 1,040.00

4 Weeks

Transient overexpression of CLDN19 (NM_148960) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CLDN19 (NM_001123395) ICC Control Block
TB425251

USD 1,070.00

4 Weeks

Transient overexpression of CLDN19 (NM_001123395) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CLDN19 (NM_001185117) ICC Control Block
TB431064

USD 1,070.00

4 Weeks

Transient overexpression of CLDN19 (NM_001185117) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CLDN19 Cytosection
TS416887

USD 225.00

4 Weeks

Transient overexpression of CLDN19 (NM_148960) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CLDN19 Cytosection
TS416887P5

USD 889.00

4 Weeks

Transient overexpression of CLDN19 (NM_148960) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

CLDN19 Cytosection
TS425251

USD 225.00

4 Weeks

Transient overexpression of CLDN19 (NM_001123395) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CLDN19 Cytosection
TS425251P5

USD 889.00

4 Weeks

Transient overexpression of CLDN19 (NM_001123395) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

CLDN19 ICC Control Sections
TS431064P5

USD 889.00

4 Weeks

Transient overexpression of CLDN19 (NM_001185117) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack