Products

Proteins (11)
Antibodies (10)
cDNA Clones (10)
Jump to Filters
View as table Download
Alpha Fodrin (SPTAN1) (NM_003127) Human Recombinant Protein
TP318210

USD 823.00

In Stock

Purified recombinant protein of Homo sapiens spectrin, alpha, non-erythrocytic 1 (alpha-fodrin) (SPTAN1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T

Special Offer: Get a 20% discount on this product. Use code: "MVPro20".

Alpha Fodrin (SPTAN1) (NM_001130438) Human Tagged ORF Clone
RC226485

USD 1,999.00

In Stock

SPTAN1 (Myc-DDK-tagged)-Human spectrin, alpha, non-erythrocytic 1 (alpha-fodrin) (SPTAN1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Alpha Fodrin (SPTAN1) (NM_001130438) Human Tagged ORF Clone Lentiviral Particle
RC226485L1V

USD 2,399.00

3 Weeks

Lenti ORF particles, SPTAN1 (Myc-DDK tagged) - Human spectrin, alpha, non-erythrocytic 1 (alpha-fodrin) (SPTAN1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
Alpha Fodrin (SPTAN1) (NM_003127) Human Tagged ORF Clone
RC218210

USD 1,999.00

In Stock

SPTAN1 (Myc-DDK-tagged)-Human spectrin, alpha, non-erythrocytic 1 (alpha-fodrin) (SPTAN1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Alpha Fodrin (SPTAN1) (NM_001195532) Human Tagged ORF Clone
RC230902

USD 1,999.00

10 Weeks

SPTAN1 (Myc-DDK-tagged)-Human spectrin, alpha, non-erythrocytic 1 (alpha-fodrin) (SPTAN1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Alpha Fodrin (SPTAN1) (NM_003127) Human Tagged ORF Clone
RG218210

USD 2,200.00

3 Weeks

SPTAN1 (GFP-tagged) - Human spectrin, alpha, non-erythrocytic 1 (alpha-fodrin) (SPTAN1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Alpha Fodrin (SPTAN1) (NM_001130438) Human Tagged ORF Clone
RG226485

USD 2,200.00

3 Weeks

SPTAN1 (GFP-tagged) - Human spectrin, alpha, non-erythrocytic 1 (alpha-fodrin) (SPTAN1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Alpha Fodrin (SPTAN1) (NM_001195532) Human Tagged ORF Clone
RG230902

USD 2,200.00

10 Weeks

SPTAN1 (GFP-tagged) - Human spectrin, alpha, non-erythrocytic 1 (alpha-fodrin) (SPTAN1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Alpha Fodrin (SPTAN1) Rabbit Polyclonal Antibody
TA344294

USD 475.00

5 Days

Rabbit Polyclonal Anti-SPTAN1 Antibody - N-terminal region

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SPTAN1 antibody: synthetic peptide directed towards the N terminal of human SPTAN1. Synthetic peptide located within the following region: MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQ
Alpha Fodrin (SPTAN1) Rabbit Polyclonal Antibody
TA314562

USD 345.00

In Stock

Rabbit polyclonal SPTA2 (Cleaved-Asp1185) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen the antiserum was produced against synthesized peptide derived from human SPTA2.
Alpha Fodrin (SPTAN1) Rabbit Polyclonal Antibody
TA336859

USD 410.00

5 Days

Rabbit Polyclonal Alpha Fodrin Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant construct containing the 7th, 8th and 9th spectrin repeats of human Alpha Fodrin (amino acids 676-1043). [UniProt# Q13813]
Alpha Fodrin (SPTAN1) (676-1043) Mouse Monoclonal Antibody
MO22110-100

USD 380.00

2 Weeks

Alpha Fodrin (SPTAN1) (676-1043) mouse monoclonal antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Alpha Fodrin (SPTAN1) (NM_003127) Human Untagged Clone
SC127754

USD 5,010.00

In Stock

SPTAN1 (untagged)-Human spectrin, alpha, non-erythrocytic 1 (alpha-fodrin) (SPTAN1), transcript variant 2

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
Alpha Fodrin (SPTAN1) Mouse Monoclonal Antibody [Clone ID: OTI9C10]
CF812019

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SPTAN1 mouse monoclonal antibody,clone OTI9C10

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Alpha Fodrin (SPTAN1) (NM_003127) Human Mass Spec Standard
PH318210

USD 2,055.00

3 Weeks

SPTAN1 MS Standard C13 and N15-labeled recombinant protein (NP_003118)

Tag C-Myc/DDK
Expression Host HEK293
Alpha Fodrin (SPTAN1) (NM_001130438) Human Mass Spec Standard
PH326485

USD 2,055.00

3 Weeks

SPTAN1 MS Standard C13 and N15-labeled recombinant protein (NP_001123910)

Tag C-Myc/DDK
Expression Host HEK293
Alpha Fodrin (SPTAN1) (NM_001130438) Human Untagged Clone
SC326440

USD 5,020.00

3 Weeks

SPTAN1 (untagged)-Human spectrin, alpha, non-erythrocytic 1 (alpha-fodrin) (SPTAN1), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Alpha Fodrin (SPTAN1) Rabbit Polyclonal Antibody
TA351749

USD 345.00

In Stock

Rabbit Polyclonal Anti-SPTAN1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SPTAN1
Alpha Fodrin (SPTAN1) Mouse Monoclonal Antibody [Clone ID: OTI9C10]
TA812019

USD 379.00

In Stock

SPTAN1 mouse monoclonal antibody,clone OTI9C10

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Alpha Fodrin (SPTAN1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9C10]
TA812019AM

USD 420.00

4 Weeks

SPTAN1 mouse monoclonal antibody,clone OTI9C10, Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
Alpha Fodrin (SPTAN1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9C10]
TA812019BM

USD 420.00

4 Weeks

SPTAN1 mouse monoclonal antibody,clone OTI9C10, HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
Alpha Fodrin (SPTAN1) Mouse Monoclonal Antibody [Clone ID: OTI9C10]
TA812019S

USD 159.00

2 Days

SPTAN1 mouse monoclonal antibody,clone OTI9C10

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Alpha Fodrin (SPTAN1) ICC Control Block
TB418210

USD 2,649.00

4 Weeks

Transient overexpression of SPTAN1 (NM_003127) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Alpha Fodrin (SPTAN1) ICC Control Block
TB426485

USD 2,649.00

4 Weeks

Transient overexpression of SPTAN1 (NM_001130438) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Alpha Fodrin (SPTAN1) ICC Control Block
TB430902

USD 2,649.00

4 Weeks

Transient overexpression of SPTAN1 (NM_001195532) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Alpha Fodrin (SPTAN1) Cytosection
TS418210

USD 225.00

4 Weeks

Transient overexpression of SPTAN1 (NM_003127) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Alpha Fodrin (SPTAN1) Cytosection
TS418210P5

USD 889.00

4 Weeks

Transient overexpression of SPTAN1 (NM_003127) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Alpha Fodrin (SPTAN1) Cytosection
TS426485

USD 225.00

4 Weeks

Transient overexpression of SPTAN1 (NM_001130438) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Alpha Fodrin (SPTAN1) Cytosection
TS426485P5

USD 889.00

4 Weeks

Transient overexpression of SPTAN1 (NM_001130438) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Alpha Fodrin (SPTAN1) ICC Control Sections
TS430902P5

USD 889.00

4 Weeks

Transient overexpression of SPTAN1 (NM_001195532) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack