Germany
Japan
United Kingdom
China
CSDA (Myc-DDK-tagged)-Human cold shock domain protein A (CSDA), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, CSDA (Myc-DDK-tagged)-Human cold shock domain protein A (CSDA), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CSDA (mGFP-tagged)-Human cold shock domain protein A (CSDA), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Recombinant protein of human cold shock domain protein A (CSDA), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
CSDA (GFP-tagged) - Human cold shock domain protein A (CSDA), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, CSDA (Myc-DDK-tagged)-Human cold shock domain protein A (CSDA), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of CSDA (mGFP-tagged)-Human cold shock domain protein A (CSDA), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CSDA (mGFP-tagged)-Human cold shock domain protein A (CSDA), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CSDA (Myc-DDK-tagged)-Human cold shock domain protein A (CSDA), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of CSDA (Myc-DDK-tagged)-Human cold shock domain protein A (CSDA), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, CSDA (Myc-DDK-tagged)-Human cold shock domain protein A (CSDA), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of CSDA (mGFP-tagged)-Human cold shock domain protein A (CSDA), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, CSDA (mGFP-tagged)-Human cold shock domain protein A (CSDA), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CSDA (GFP-tagged) - Human cold shock domain protein A (CSDA), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CSDA (untagged)-Human cold shock domain protein A (CSDA), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti-ORF clone of CSDA (Myc-DDK-tagged)-Human cold shock domain protein A (CSDA), transcript variant 1
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-YBX3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CSDA antibody: synthetic peptide directed towards the N terminal of human CSDA. Synthetic peptide located within the following region: AHVAGNPGGDAAPAATGTAAAASLAAAAGSEDAEKKVLATKVLGTVKWFN |
Rabbit polyclonal CSDA Antibody (Center)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CSDA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 152-181 amino acids from the Central region of human CSDA. |
Transient overexpression lysate of cold shock domain protein A (CSDA), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CSDA (untagged)-Human cold shock domain protein A (CSDA), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
YBX3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Rabbit Polyclonal Anti-YBX3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CSDA antibody: synthetic peptide directed towards the C terminal of human CSDA. Synthetic peptide located within the following region: RYRSRGPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYRRPYNYRRRP |
Rabbit Polyclonal Anti-YBX3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CSDA antibody: synthetic peptide directed towards the C terminal of human CSDA. Synthetic peptide located within the following region: GPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYRRPYNYRRRPRPPNA |
CSDA MS Standard C13 and N15-labeled recombinant protein (NP_003642)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
CSDA (untagged)-Human cold shock domain protein A (CSDA), transcript variant 2, mRNA
| Vector | pCMV6 series |
| Tag | Tag Free |
Transient overexpression of YBX3 (NM_003651) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of YBX3 (NM_001145426) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of YBX3 (NM_003651) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of YBX3 (NM_003651) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of YBX3 (NM_001145426) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- YBX3
Pathways
- Tight junction