Germany
Japan
United Kingdom
China
LBP (Myc-DDK-tagged)-Human lipopolysaccharide binding protein (LBP)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, LBP (Myc-DDK tagged) - Human lipopolysaccharide binding protein (LBP), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, LBP (mGFP-tagged) - Human lipopolysaccharide binding protein (LBP), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF clone of Human lipopolysaccharide binding protein (LBP), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, LBP (Myc-DDK tagged) - Human lipopolysaccharide binding protein (LBP), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human lipopolysaccharide binding protein (LBP), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, LBP (mGFP-tagged) - Human lipopolysaccharide binding protein (LBP), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
LBP (GFP-tagged) - Human lipopolysaccharide binding protein (LBP)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human lipopolysaccharide binding protein (LBP), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
LBP (untagged)-Human lipopolysaccharide binding protein (LBP)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-LBP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LBP antibody: synthetic peptide directed towards the middle region of human LBP. Synthetic peptide located within the following region: LLGSESSGRPTVTASSCSSDIADVEVDMSGDLGWLLNLFHNQIESKFQKV |
LBP HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-LBP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LBP antibody: synthetic peptide directed towards the C terminal of human LBP. Synthetic peptide located within the following region: FLKPGKVKVELKESKVGLFNAELLEALLNYYILNTFYPKFNDKLAEGFPL |
Lenti ORF clone of Human lipopolysaccharide binding protein (LBP), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of lipopolysaccharide binding protein (LBP)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression of LBP (NM_004139) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human lipopolysaccharide binding protein (LBP)
| Tag | C-His |
| Expression Host | HEK293 |
Recombinant protein of human lipopolysaccharide binding protein (LBP)
| Tag | C-His |
| Expression Host | HEK293 |
Recombinant protein of human lipopolysaccharide binding protein (LBP)
| Tag | C-His |
| Expression Host | HEK293 |
Recombinant protein of human lipopolysaccharide binding protein (LBP)
| Tag | C-His |
| Expression Host | HEK293 |
Transient overexpression of LBP (NM_004139) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of LBP (NM_004139) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- LBP
Pathways
- Toll-like receptor signaling pathway