Germany
Japan
United Kingdom
China
INMT (Myc-DDK-tagged)-Human indolethylamine N-methyltransferase (INMT), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human indolethylamine N-methyltransferase (INMT)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF clone of Human indolethylamine N-methyltransferase (INMT), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, INMT (Myc-DDK tagged) - Human indolethylamine N-methyltransferase (INMT), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human indolethylamine N-methyltransferase (INMT), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, INMT (mGFP-tagged) - Human indolethylamine N-methyltransferase (INMT), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
INMT (Myc-DDK tagged) - Homo sapiens indolethylamine N-methyltransferase (INMT), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
INMT (GFP-tagged) - Human indolethylamine N-methyltransferase (INMT), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
INMT (GFP-tagged) - Homo sapiens indolethylamine N-methyltransferase (INMT), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal Anti-INMT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-INMT antibody: synthetic peptide directed towards the N terminal of human INMT. Synthetic peptide located within the following region: KGGFTGGDEYQKHFLPRDYLATYYSFDGSPSPEAEMLKFNLECLHKTFGP |
Purified recombinant protein of Human indolethylamine N-methyltransferase (INMT), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
INMT (untagged) - Homo sapiens indolethylamine N-methyltransferase (INMT), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
INMT HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of indolethylamine N-methyltransferase (INMT)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
INMT MS Standard C13 and N15-labeled recombinant protein (NP_006765)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
INMT (untagged)-Human indolethylamine N-methyltransferase (INMT), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of INMT (NM_006774) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of INMT (NM_001199219) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of INMT (NM_006774) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of INMT (NM_006774) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of INMT (NM_001199219) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- INMT
Pathways
- Tryptophan metabolism