Products

View as table Download

PDX1 (Myc-DDK-tagged)-Human pancreatic and duodenal homeobox 1 (PDX1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

PDX1 (untagged)-Human pancreatic and duodenal homeobox 1 (PDX1)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

PDX1 (GFP-tagged) - Human pancreatic and duodenal homeobox 1 (PDX1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, PDX1 (Myc-DDK tagged) - Human pancreatic and duodenal homeobox 1 (PDX1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF clone of Human pancreatic and duodenal homeobox 1 (PDX1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PDX1 (Myc-DDK tagged) - Human pancreatic and duodenal homeobox 1 (PDX1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human pancreatic and duodenal homeobox 1 (PDX1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PDX1 (mGFP-tagged) - Human pancreatic and duodenal homeobox 1 (PDX1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human pancreatic and duodenal homeobox 1 (PDX1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human pancreatic and duodenal homeobox 1 (PDX1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF particles, PDX1 (mGFP-tagged) - Human pancreatic and duodenal homeobox 1 (PDX1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Transient overexpression lysate of pancreatic and duodenal homeobox 1 (PDX1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit anti-PDX1 Polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human PDX1

PDX1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

Rabbit Polyclonal PDX-1/IPF1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human PDX1 protein (between residues 100-200) [UniProt P52945]

Rabbit polyclonal IPF Antibody (C-term)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This IPF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from the C-terminal region of human IPF.

Rabbit Polyclonal Anti-PDX1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PDX1 antibody: synthetic peptide directed towards the N terminal of human PDX1. Synthetic peptide located within the following region: MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPF

Purified recombinant protein of Human pancreatic and duodenal homeobox 1 (PDX1), with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli

Rabbit anti PDX-1 Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) Pdx1 mouse monoclonal antibody, clone OTI2A12 (formerly 2A12)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) Pdx1 mouse monoclonal antibody, clone OTI5D5 (formerly 5D5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PDX1 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PDX1 mouse monoclonal antibody, clone OTI4D8 (formerly 4D8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PDX1 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PDX1 mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PDX1 mouse monoclonal antibody, clone OTI7F7 (formerly 7F7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDX1 MS Standard C13 and N15-labeled recombinant protein (NP_000200)

Tag C-Myc/DDK
Expression Host HEK293

Anti-PDX1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 18-31 amino acids of human pancreatic and duodenal homeobox 1

Anti-PDX1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 18-31 amino acids of human pancreatic and duodenal homeobox 1

Pdx1 mouse monoclonal antibody, clone OTI2A12 (formerly 2A12)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Pdx1 mouse monoclonal antibody, clone OTI2A12 (formerly 2A12)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Pdx1 mouse monoclonal antibody, clone OTI5D5 (formerly 5D5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Pdx1 mouse monoclonal antibody, clone OTI5D5 (formerly 5D5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDX1 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDX1 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

PDX1 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

PDX1 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDX1 mouse monoclonal antibody, clone OTI4D8 (formerly 4D8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDX1 mouse monoclonal antibody, clone OTI4D8 (formerly 4D8), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

PDX1 mouse monoclonal antibody, clone OTI4D8 (formerly 4D8), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

PDX1 mouse monoclonal antibody, clone OTI4D8 (formerly 4D8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDX1 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDX1 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

PDX1 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

PDX1 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDX1 mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated