Products

Proteins (13)
cDNA Clones (12)
Antibodies (8)
Jump to Filters
View as table Download
Aspartate Aminotransferase (GOT1) (NM_002079) Human Recombinant Protein
TP301757

USD 823.00

In Stock

Recombinant protein of human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1)

Tag C-Myc/DDK
Expression Host HEK293T

Special Offer: Get a 15% discount on this product. Use code: “NEURO15".

Aspartate Aminotransferase (GOT1) (NM_002079) Human Tagged ORF Clone Lentiviral Particle
RC201757L1V

USD 820.00

3 Weeks

Lenti ORF particles, GOT1 (Myc-DDK tagged) - Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
Aspartate Aminotransferase (GOT1) (NM_002079) Human Tagged ORF Clone
RG201757

USD 460.00

In Stock

GOT1 (GFP-tagged) - Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Aspartate Aminotransferase (GOT1) (NM_002079) Human Tagged ORF Clone Lentiviral Particle
RC201757L3V

USD 820.00

5 Weeks

Lenti ORF particles, GOT1 (Myc-DDK tagged) - Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Aspartate Aminotransferase (GOT1) (NM_002079) Human Tagged ORF Clone Lentiviral Particle
RC201757L4V

USD 820.00

7 Weeks

Lenti ORF particles, GOT1 (mGFP-tagged) - Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Aspartate Aminotransferase (GOT1) Rabbit Polyclonal Antibody
TA346569

USD 475.00

5 Days

Rabbit Polyclonal Anti-GOT1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GOT1 antibody: synthetic peptide directed towards the N terminal of human GOT1. Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV
Aspartate Aminotransferase (GOT1) (NM_002079) Human Untagged Clone
SC320596

USD 310.00

In Stock

GOT1 (untagged)-Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Aspartate Aminotransferase (GOT1) Goat Polyclonal Antibody
TA303313

USD 375.00

In Stock

Goat Polyclonal Antibody against GOT1 (Internal region)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RSYRYWDAEKR, from the internal region of the protein sequence according to NP_002070.1.
Aspartate Aminotransferase (GOT1) Rabbit Polyclonal Antibody
TA346570

USD 410.00

5 Days

Rabbit Polyclonal Anti-GOT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GOT1 antibody: synthetic peptide directed towards the N terminal of human GOT1. Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV
Aspartate Aminotransferase (GOT1) (NM_002079) Human Tagged ORF Clone
RC201757L1

USD 768.00

In Stock

Lenti ORF clone of Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Aspartate Aminotransferase (GOT1) (NM_002079) Human Over-expression Lysate
LY400762

USD 396.00

In Stock

Transient overexpression lysate of glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Aspartate Aminotransferase (GOT1) (NM_002079) Human Untagged Clone
SC118816

USD 310.00

In Stock

GOT1 (untagged)-Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Aspartate Aminotransferase (GOT1) Goat Polyclonal Antibody
TA318035

USD 425.00

In Stock

Aspartate Aminotransferase Goat Polyclonal (aa157-167) Antibody

Applications IHC
Reactivities Gibbon, Chimpanzee, Gorilla, Hamster, Human, Orang-Utan, Rat
Conjugation Unconjugated
Immunogen Aspartate Aminotransferase antibody was raised against synthetic peptide C-RSYRYWDAEKR from an internal region of human GOT1 (NP_002070.1). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Rat, Hamster, Elephant (100%); Marmoset, Goat, Pig, Lizard (91%); Mouse, Panda, Bat, Bovine, Horse, Opossum, Turkey, Chicken, Platypus, Xenopus, Salmon, Pufferfish, Seq squirt (82%).
Aspartate Aminotransferase (GOT1) (NM_002079) Human Tagged ORF Clone
RC201757L2

USD 620.00

3 Weeks

Lenti ORF clone of Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Aspartate Aminotransferase (GOT1) Rabbit Polyclonal Antibody
TA332939

USD 345.00

3 Weeks

Rabbit anti-GOT1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GOT1
Aspartate Aminotransferase (GOT1) (N-term) Rabbit Polyclonal Antibody
AP18039PU-N

USD 450.00

2 Weeks

Aspartate Aminotransferase (GOT1) (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human GOT1
Aspartate Aminotransferase (GOT1) Goat Polyclonal Antibody
TA303294

USD 375.00

5 Days

Goat Polyclonal Antibody against GOT1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TADFREDPDPRKVN, from the internal region of the protein sequence according to NP_002070.1.
GOT1 (1-413, His-tag) Human Protein
AR09537PU-L

USD 745.00

2 Weeks

GOT1 (1-413, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
GOT1 (1-413, His-tag) Human Protein
AR09537PU-N

USD 300.00

2 Weeks

GOT1 (1-413, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
Aspartate Aminotransferase (GOT1) Rabbit Polyclonal Antibody
TA349690

USD 345.00

In Stock

Rabbit Polyclonal Anti-GOT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GOT1
Aspartate Aminotransferase (GOT1) ICC Control Block
TB401757

USD 1,070.00

4 Weeks

Transient overexpression of GOT1 (NM_002079) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Aspartate Aminotransferase (GOT1) (NM_002079) Human Recombinant Protein
TP720124

USD 330.00

3 Weeks

Recombinant protein of human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1)

Tag C-His
Expression Host E. coli
Aspartate Aminotransferase (GOT1) (NM_002079) Human Recombinant Protein
TP720124L

USD 1,900.00

3 Weeks

Recombinant protein of human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1)

Tag C-His
Expression Host E. coli
Aspartate Aminotransferase (GOT1) (NM_002079) Human Recombinant Protein
TP720124M

USD 760.00

3 Weeks

Recombinant protein of human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1)

Tag C-His
Expression Host E. coli
Aspartate Aminotransferase (GOT1) (NM_002079) Human Recombinant Protein
TP720124XL

USD 2,800.00

3 Weeks

Recombinant protein of human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1)

Tag C-His
Expression Host E. coli
Aspartate Aminotransferase (GOT1) Cytosection
TS401757

USD 225.00

4 Weeks

Transient overexpression of GOT1 (NM_002079) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Aspartate Aminotransferase (GOT1) Cytosection
TS401757P5

USD 889.00

4 Weeks

Transient overexpression of GOT1 (NM_002079) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack