Products

View as table Download

Got1 (Myc-DDK-tagged) - Mouse glutamate oxaloacetate transaminase 1, soluble (Got1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Recombinant protein of human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1)

Tag C-Myc/DDK
Expression Host HEK293T

Special Offer: Get a 15% discount on this product. Use code: “NEURO15".

Lenti ORF particles, Got1 (Myc-DDK-tagged) - Mouse glutamate oxaloacetate transaminase 1, soluble (Got1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, Got1 (GFP-tagged) - Mouse glutamate oxaloacetate transaminase 1, soluble (Got1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Lenti ORF particles, GOT1 (Myc-DDK tagged) - Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

GOT1 (GFP-tagged) - Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Got1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN507128 is the updated version of KN307128.

Got1 (GFP-tagged) - Mouse glutamate oxaloacetate transaminase 1, soluble (cDNA clone MGC:6100 IMAGE:3489628)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Got1 (Myc-DDK-tagged) - Mouse glutamate oxaloacetate transaminase 1, soluble (Got1)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Got1 (Myc-DDK-tagged) - Mouse glutamate oxaloacetate transaminase 1, soluble (Got1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Got1 (mGFP-tagged) - Mouse glutamate oxaloacetate transaminase 1, soluble (Got1)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Got1 (GFP-tagged) - Mouse glutamate oxaloacetate transaminase 1, soluble (Got1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GOT1 (Myc-DDK tagged) - Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GOT1 (mGFP-tagged) - Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Got1 (Myc-DDK-tagged ORF) - Rat glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (Got1), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Got1 (Myc-DDK-tagged ORF) - Rat glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (Got1), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Got1 (Myc-DDK-tagged ORF) - Rat glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (Got1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Got1 (mGFP-tagged ORF) - Rat glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (Got1), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Got1 (GFP-tagged ORF) - Rat glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (Got1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit Polyclonal Anti-GOT1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GOT1 antibody: synthetic peptide directed towards the N terminal of human GOT1. Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV

Lenti ORF clone of Got1 (Myc-DDK-tagged) - Mouse glutamate oxaloacetate transaminase 1, soluble (Got1)

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

GOT1 (untagged)-Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Goat Polyclonal Antibody against GOT1 (Internal region)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RSYRYWDAEKR, from the internal region of the protein sequence according to NP_002070.1.

Rabbit Polyclonal Anti-GOT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GOT1 antibody: synthetic peptide directed towards the N terminal of human GOT1. Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV

Lenti ORF clone of Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

GOT1 rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IP, R, WB
Reactivities Porcine
Immunogen Glutamate-Oxaloacetate Transaminase isolated and purified from Porcine heart.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

GOT1 rabbit polyclonal antibody, Biotin

Applications ELISA, ID, IF, IP, R, WB
Reactivities Porcine
Conjugation Biotin
Immunogen Glutamate-Oxaloacetate Transaminase isolated and purified from Porcine heart.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Transient overexpression lysate of glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

GOT1 (untagged)-Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Aspartate Aminotransferase Goat Polyclonal (aa157-167) Antibody

Applications IHC
Reactivities Gibbon, Chimpanzee, Gorilla, Hamster, Human, Orang-Utan, Rat
Conjugation Unconjugated
Immunogen Aspartate Aminotransferase antibody was raised against synthetic peptide C-RSYRYWDAEKR from an internal region of human GOT1 (NP_002070.1). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Rat, Hamster, Elephant (100%); Marmoset, Goat, Pig, Lizard (91%); Mouse, Panda, Bat, Bovine, Horse, Opossum, Turkey, Chicken, Platypus, Xenopus, Salmon, Pufferfish, Seq squirt (82%).

Lenti ORF clone of Got1 (mGFP-tagged) - Mouse glutamate oxaloacetate transaminase 1, soluble (Got1)

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

GOT1 sheep polyclonal antibody, Biotin, Purified

Applications ELISA, WB
Reactivities Porcine
Conjugation Biotin
Immunogen Aspartate aminotransferase / GOT1 from porcine heart

Lenti ORF clone of Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

GOT1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

qSTAR qPCR primer pairs against Homo sapiens gene GOT1

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)

Rabbit anti-GOT1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GOT1

Got1 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti

Aspartate Aminotransferase (GOT1) (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human GOT1

qSTAR qPCR primer pairs against Mus musculus gene Got1

Goat Polyclonal Antibody against GOT1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TADFREDPDPRKVN, from the internal region of the protein sequence according to NP_002070.1.

GOT1 (1-413, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli

GOT1 (1-413, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli

GOT1 (1-413, His-tag) mouse recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli

GOT1 (1-413, His-tag) mouse recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli

GOT1 CRISPRa kit - CRISPR gene activation of human glutamic-oxaloacetic transaminase 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector