Germany
Japan
United Kingdom
China
GOT1 (Myc-DDK-tagged)-Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Got1 (Myc-DDK-tagged) - Mouse glutamate oxaloacetate transaminase 1, soluble (Got1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 823.00
In Stock
Recombinant protein of human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
Lenti ORF particles, Got1 (Myc-DDK-tagged) - Mouse glutamate oxaloacetate transaminase 1, soluble (Got1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, Got1 (GFP-tagged) - Mouse glutamate oxaloacetate transaminase 1, soluble (Got1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, GOT1 (Myc-DDK tagged) - Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, GOT1 (mGFP-tagged) - Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
GOT1 (GFP-tagged) - Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Got1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN507128 is the updated version of KN307128.
Got1 (GFP-tagged) - Mouse glutamate oxaloacetate transaminase 1, soluble (cDNA clone MGC:6100 IMAGE:3489628)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Got1 (Myc-DDK-tagged) - Mouse glutamate oxaloacetate transaminase 1, soluble (Got1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Got1 (Myc-DDK-tagged) - Mouse glutamate oxaloacetate transaminase 1, soluble (Got1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Got1 (mGFP-tagged) - Mouse glutamate oxaloacetate transaminase 1, soluble (Got1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Got1 (GFP-tagged) - Mouse glutamate oxaloacetate transaminase 1, soluble (Got1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, GOT1 (Myc-DDK tagged) - Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
7 Weeks
Lenti ORF particles, GOT1 (mGFP-tagged) - Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Got1 (Myc-DDK-tagged ORF) - Rat glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (Got1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Got1 (Myc-DDK-tagged ORF) - Rat glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (Got1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Got1 (Myc-DDK-tagged ORF) - Rat glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (Got1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Got1 (mGFP-tagged ORF) - Rat glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (Got1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Got1 (GFP-tagged ORF) - Rat glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (Got1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal Anti-GOT1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GOT1 antibody: synthetic peptide directed towards the N terminal of human GOT1. Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV |
Lenti ORF clone of Got1 (Myc-DDK-tagged) - Mouse glutamate oxaloacetate transaminase 1, soluble (Got1)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
GOT1 (untagged)-Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Goat Polyclonal Antibody against GOT1 (Internal region)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RSYRYWDAEKR, from the internal region of the protein sequence according to NP_002070.1. |
Rabbit Polyclonal Anti-GOT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GOT1 antibody: synthetic peptide directed towards the N terminal of human GOT1. Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV |
Lenti ORF clone of Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
GOT1 rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Porcine |
| Immunogen | Glutamate-Oxaloacetate Transaminase isolated and purified from Porcine heart. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
GOT1 rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Porcine |
| Conjugation | Biotin |
| Immunogen | Glutamate-Oxaloacetate Transaminase isolated and purified from Porcine heart. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
USD 396.00
In Stock
Transient overexpression lysate of glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
GOT1 (untagged)-Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Aspartate Aminotransferase Goat Polyclonal (aa157-167) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Chimpanzee, Gorilla, Hamster, Human, Orang-Utan, Rat |
| Conjugation | Unconjugated |
| Immunogen | Aspartate Aminotransferase antibody was raised against synthetic peptide C-RSYRYWDAEKR from an internal region of human GOT1 (NP_002070.1). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Rat, Hamster, Elephant (100%); Marmoset, Goat, Pig, Lizard (91%); Mouse, Panda, Bat, Bovine, Horse, Opossum, Turkey, Chicken, Platypus, Xenopus, Salmon, Pufferfish, Seq squirt (82%). |
Lenti ORF clone of Got1 (mGFP-tagged) - Mouse glutamate oxaloacetate transaminase 1, soluble (Got1)
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
GOT1 sheep polyclonal antibody, Biotin, Purified
| Applications | ELISA, WB |
| Reactivities | Porcine |
| Conjugation | Biotin |
| Immunogen | Aspartate aminotransferase / GOT1 from porcine heart |
Lenti ORF clone of Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
GOT1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
qSTAR qPCR primer pairs against Homo sapiens gene GOT1
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
USD 121.00
In Stock
GOT1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Got1 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
USD 512.00
2 Weeks
Aspartate Aminotransferase (GOT1) (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human GOT1 |
qSTAR qPCR primer pairs against Mus musculus gene Got1
Goat Polyclonal Antibody against GOT1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TADFREDPDPRKVN, from the internal region of the protein sequence according to NP_002070.1. |
GOT1 (1-413, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
GOT1 (1-413, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
GOT1 (1-413, His-tag) mouse recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
GOT1 (1-413, His-tag) mouse recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
GOT1 CRISPRa kit - CRISPR gene activation of human glutamic-oxaloacetic transaminase 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Active filters
Target Symbol
- GOT1