Germany
Japan
United Kingdom
China
MIF (Myc-DDK-tagged)-Human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
MIF (untagged)-Human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Recombinant protein of human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF particles, MIF (Myc-DDK tagged) - Human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, MIF (mGFP-tagged) - Human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
MIF (GFP-tagged) - Human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, MIF (Myc-DDK tagged) - Human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, MIF (mGFP-tagged) - Human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Purified recombinant protein of Human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF).
| Tag | N-His |
| Expression Host | Hi-5 insect |
Lenti ORF clone of Human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit anti-MIF Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MIF |
Transient overexpression lysate of macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
MIF HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Rabbit polyclonal anti-macrophage migration inhibitory factor (MIF) antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 67 of human MIF |
Chicken polyclonal anti-MIF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IgY fraction antibody was prepared from eggs of chickens laid after repeated immunizations with a synthetic peptide corresponding to aa 2-32 of Human MIF conjugated to keyhole limpet hemocyanin (KLH). MIF is a proinflammatory cytokine that plays an important role in systemic inflammatory events. |
Rabbit Polyclonal Anti-MIF Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MIF antibody: synthetic peptide directed towards the middle region of human MIF. Synthetic peptide located within the following region: PQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLL |
MIF (1-115) human recombinant protein, 0.5 mg
| Expression Host | E. coli |
MIF (1-115) human recombinant protein, 0.1 mg
| Expression Host | E. coli |
MIF (1-115, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
MIF (1-115, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
MIF MS Standard C13 and N15-labeled recombinant protein (NP_002406)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
MIF (1-115, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
MIF (1-115, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
Transient overexpression of MIF (NM_002415) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF)
| Tag | tag free |
| Expression Host | E. coli |
Purified recombinant protein of Human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF)
| Tag | tag free |
| Expression Host | E. coli |
Purified recombinant protein of Human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF)
| Tag | tag free |
| Expression Host | E. coli |
Purified recombinant protein of Human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF)
| Tag | tag free |
| Expression Host | E. coli |
Transient overexpression of MIF (NM_002415) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MIF (NM_002415) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- MIF
Pathways
- Tyrosine metabolism