Germany
Japan
United Kingdom
China
ACAT1 (Myc-DDK-tagged)-Human acetyl-CoA acetyltransferase 1 (ACAT1), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, ACAT1 (Myc-DDK-tagged)-Human acetyl-CoA acetyltransferase 1 (ACAT1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, ACAT1 (mGFP-tagged)-Human acetyl-CoA acetyltransferase 1 (ACAT1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti-ORF clone of ACAT1 (Myc-DDK-tagged)-Human acetyl-CoA acetyltransferase 1 (ACAT1), nuclear gene encoding mitochondrial protein
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ACAT1 (Myc-DDK-tagged)-Human acetyl-CoA acetyltransferase 1 (ACAT1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, ACAT1 (mGFP-tagged)-Human acetyl-CoA acetyltransferase 1 (ACAT1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ACAT1 (GFP-tagged) - Human acetyl-CoA acetyltransferase 1 (ACAT1), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of ACAT1 (mGFP-tagged)-Human acetyl-CoA acetyltransferase 1 (ACAT1), nuclear gene encoding mitochondrial protein
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Goat Polyclonal Anti-ACAT1 (aa257-269) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACAT1 (aa257-269) Antibody: Peptide with sequence C-KRVDFSKVPKLKT, from the internal region of the protein sequence according to NP_000010.1. |
ACAT1 mouse monoclonal antibody, clone AT15E5, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Lenti-ORF clone of ACAT1 (Myc-DDK-tagged)-Human acetyl-CoA acetyltransferase 1 (ACAT1), nuclear gene encoding mitochondrial protein
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
ACAT1 (untagged)-Human acetyl-CoA acetyltransferase 1 (ACAT1), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
ACAT1 (N-term) mouse monoclonal antibody, clone AT1.H11, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
ACAT1 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide |
Lenti-ORF clone of ACAT1 (mGFP-tagged)-Human acetyl-CoA acetyltransferase 1 (ACAT1), nuclear gene encoding mitochondrial protein
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
ACAT1 (untagged)-Homo sapiens, Similar to acetyl-Coenzyme A acetyltransferase 1 (acetoacetyl Coenzyme A thiolase), clone MGC:13582 IMAGE:4278329, complete cds
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
ACAT1 mouse monoclonal antibody, clone AT15E5, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
ACAT1 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Porcine, Rat |
| Immunogen | Synthetic peptide |
ACAT1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of acetyl-Coenzyme A acetyltransferase 1 (ACAT1), nuclear gene encoding mitochondrial protein
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-ACAT1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACAT1 Antibody: synthetic peptide directed towards the middle region of human ACAT1. Synthetic peptide located within the following region: GHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTDVYNKIH |
Rabbit Polyclonal Anti-ACAT1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACAT1 Antibody: synthetic peptide directed towards the middle region of human ACAT1. Synthetic peptide located within the following region: SYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKL |
Mouse anti-ACAT1 monoclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti-ACAT1 polyclonal antibody
| Applications | WB |
| Reactivities | Human, Porcine, Rat, Murine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human ACAT1. |
Goat Anti-ACAT1 (aa253-266) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DEEYKRVDFSKVPK, from the internal region of the protein sequence according to NP_000010.1. |
ACAT1 / MAT (34-427, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
ACAT1 / MAT (34-427, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
Transient overexpression of ACAT1 (NM_000019) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ACAT1 (NM_000019) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ACAT1 (NM_000019) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- ACAT1
Pathways
- Valine