PCCA (Myc-DDK-tagged)-Human propionyl CoA carboxylase, alpha polypeptide (PCCA), nuclear gene encoding mitochondrial protein, transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PCCA (Myc-DDK-tagged)-Human propionyl CoA carboxylase, alpha polypeptide (PCCA), nuclear gene encoding mitochondrial protein, transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PCCA (Myc-DDK-tagged)-Human propionyl CoA carboxylase, alpha polypeptide (PCCA), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human propionyl Coenzyme A carboxylase, alpha polypeptide (PCCA), nuclear gene encoding mitochondrial protein, transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, PCCA (Myc-DDK tagged) - Human propionyl CoA carboxylase, alpha polypeptide (PCCA), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, PCCA (mGFP-tagged) - Human propionyl CoA carboxylase, alpha polypeptide (PCCA), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
PCCA (GFP-tagged) - Human propionyl CoA carboxylase, alpha polypeptide (PCCA), nuclear gene encoding mitochondrial protein, transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human propionyl CoA carboxylase, alpha polypeptide (PCCA), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PCCA (Myc-DDK tagged) - Human propionyl CoA carboxylase, alpha polypeptide (PCCA), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human propionyl CoA carboxylase, alpha polypeptide (PCCA), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PCCA (mGFP-tagged) - Human propionyl CoA carboxylase, alpha polypeptide (PCCA), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PCCA (Myc-DDK-tagged)-Human propionyl CoA carboxylase, alpha polypeptide (PCCA), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of PCCA (Myc-DDK-tagged)-Human propionyl CoA carboxylase, alpha polypeptide (PCCA), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PCCA (Myc-DDK-tagged)-Human propionyl CoA carboxylase, alpha polypeptide (PCCA), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PCCA (mGFP-tagged)-Human propionyl CoA carboxylase, alpha polypeptide (PCCA), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PCCA (mGFP-tagged)-Human propionyl CoA carboxylase, alpha polypeptide (PCCA), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PCCA (Myc-DDK-tagged)-Human propionyl CoA carboxylase, alpha polypeptide (PCCA), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PCCA (Myc-DDK-tagged)-Human propionyl CoA carboxylase, alpha polypeptide (PCCA), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PCCA (mGFP-tagged)-Human propionyl CoA carboxylase, alpha polypeptide (PCCA), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PCCA (mGFP-tagged)-Human propionyl CoA carboxylase, alpha polypeptide (PCCA), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PCCA (GFP-tagged) - Human propionyl CoA carboxylase, alpha polypeptide (PCCA), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PCCA (GFP-tagged) - Human propionyl CoA carboxylase, alpha polypeptide (PCCA), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human propionyl CoA carboxylase, alpha polypeptide (PCCA), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Transient overexpression lysate of propionyl Coenzyme A carboxylase, alpha polypeptide (PCCA), nuclear gene encoding mitochondrial protein, transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PCCA (untagged)-Human propionyl CoA carboxylase, alpha polypeptide (PCCA), nuclear gene encoding mitochondrial protein, transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
PCCA HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of propionyl CoA carboxylase, alpha polypeptide (PCCA), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human propionyl CoA carboxylase, alpha polypeptide (PCCA), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-PCCA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PCCA Antibody: synthetic peptide directed towards the N terminal of human PCCA. Synthetic peptide located within the following region: LYYSRQCLMVSRNLGSVGYDPNEKTFDKILVANRGEIACRVIRTCKKMGI |
PCCA (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 336-365 amino acids from the Central region of human PCCA |
(untagged)-Human propionyl-CoA carboxylase alpha subunit (PCCA) mRNA, complete cds, nuclear gene for mitochondrial product
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Carrier-free (BSA/glycerol-free) PCCA mouse monoclonal antibody,clone OTI1B10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PCCA mouse monoclonal antibody,clone OTI1E9
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PCCA HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
PCCA MS Standard C13 and N15-labeled recombinant protein (NP_000273)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
PCCA (untagged)-Human propionyl CoA carboxylase, alpha polypeptide (PCCA), nuclear gene encoding mitochondrial protein, transcript variant 1
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
PCCA (untagged)-Human propionyl CoA carboxylase, alpha polypeptide (PCCA), transcript variant 2
Vector | pCMV6 series |
Tag | Tag Free |
PCCA (untagged)-Human propionyl CoA carboxylase alpha polypeptide (PCCA) transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
PCCA mouse monoclonal antibody,clone OTI1B10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PCCA mouse monoclonal antibody,clone OTI1B10, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PCCA mouse monoclonal antibody,clone OTI1B10, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PCCA mouse monoclonal antibody,clone OTI1B10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PCCA mouse monoclonal antibody,clone OTI1E9
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PCCA mouse monoclonal antibody,clone OTI1E9, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PCCA mouse monoclonal antibody,clone OTI1E9, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PCCA mouse monoclonal antibody,clone OTI1E9
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression of PCCA (NM_000282) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PCCA (NM_001127692) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PCCA (NM_001178004) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PCCA (NM_000282) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PCCA (NM_000282) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack