USD 98.00
USD 470.00
In Stock
PPP1CB (Myc-DDK-tagged)-Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 98.00
USD 470.00
In Stock
PPP1CB (Myc-DDK-tagged)-Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PPP1CB (Myc-DDK-tagged)-Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 823.00
In Stock
Recombinant protein of human protein phosphatase 1, catalytic subunit, beta isoform (PPP1CB), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 820.00
3 Weeks
Lenti ORF particles, PPP1CB (Myc-DDK tagged) - Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, PPP1CB (mGFP-tagged) - Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 820.00
3 Weeks
Lenti ORF particles, PPP1CB (Myc-DDK tagged) - Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, PPP1CB (mGFP-tagged) - Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
PPP1CB (GFP-tagged) - Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PPP1CB (GFP-tagged) - Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 620.00
In Stock
Lenti ORF clone of Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, PPP1CB (Myc-DDK tagged) - Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, PPP1CB (mGFP-tagged) - Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 620.00
3 Weeks
Lenti ORF clone of Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, PPP1CB (Myc-DDK tagged) - Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 620.00
3 Weeks
Lenti ORF clone of Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, PPP1CB (mGFP-tagged) - Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit anti-PPP1CB Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PPP1CB |
PPP1CB (untagged)-Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
USD 768.00
In Stock
Lenti ORF clone of Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
USD 524.00
In Stock
Rabbit Monoclonal Antibody against PPP1CB (Clone EP1804Y)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 620.00
3 Weeks
Lenti ORF clone of Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
USD 620.00
3 Weeks
Lenti ORF clone of Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
USD 121.00
In Stock
PPP1CB HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
USD 396.00
5 Days
Transient overexpression lysate of protein phosphatase 1, catalytic subunit, beta isoform (PPP1CB), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PPP1CB (untagged)-Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 3
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal Protein Phosphatase 1 beta (PPP1CB) Antibody (C-term)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This Protein Phosphatase 1 beta (PPP1CB) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 286-315 amino acids from the C-terminal region of human Protein Phosphatase 1 beta (PPP1CB). |
USD 396.00
5 Days
Transient overexpression lysate of protein phosphatase 1, catalytic subunit, beta isoform (PPP1CB), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-PPP1CB Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPP1CB antibody is: synthetic peptide directed towards the C-terminal region of Human PPP1CB. Synthetic peptide located within the following region: LFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRP |
Rabbit Polyclonal Anti-PPP1CB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPP1CB antibody is: synthetic peptide directed towards the C-terminal region of Human PPP1CB. Synthetic peptide located within the following region: VPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLI |
USD 121.00
2 Weeks
PPP1CB HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
USD 2,055.00
3 Weeks
PPP1CB MS Standard C13 and N15-labeled recombinant protein (NP_996759)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Anti-PPP1CB Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to N terminal 327 amino acids of human protein phosphatase 1, catalytic subunit, beta isozyme |
Anti-PPP1CB Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to N terminal 327 amino acids of human protein phosphatase 1, catalytic subunit, beta isozyme |
Transient overexpression of PPP1CB (NM_206876) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PPP1CB (NM_002709) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PPP1CB (NM_206876) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PPP1CB (NM_206876) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PPP1CB (NM_002709) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PPP1CB (NM_002709) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack