Germany
Japan
United Kingdom
China
USD 98.00
USD 470.00
In Stock
PPP1CB (Myc-DDK-tagged)-Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
PPP1CB (Myc-DDK-tagged)-Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
USD 823.00
In Stock
Recombinant protein of human protein phosphatase 1, catalytic subunit, beta isoform (PPP1CB), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 820.00
3 Weeks
Lenti ORF particles, PPP1CB (Myc-DDK tagged) - Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, PPP1CB (mGFP-tagged) - Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, PPP1CB (Myc-DDK tagged) - Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, PPP1CB (mGFP-tagged) - Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
PPP1CB (GFP-tagged) - Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PPP1CB (GFP-tagged) - Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 620.00
In Stock
Lenti ORF clone of Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, PPP1CB (Myc-DDK tagged) - Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, PPP1CB (mGFP-tagged) - Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 620.00
3 Weeks
Lenti ORF clone of Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, PPP1CB (Myc-DDK tagged) - Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 620.00
3 Weeks
Lenti ORF clone of Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
7 Weeks
Lenti ORF particles, PPP1CB (mGFP-tagged) - Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PPP1CB (untagged)-Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
USD 768.00
In Stock
Lenti ORF clone of Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
USD 524.00
In Stock
USD 620.00
3 Weeks
Lenti ORF clone of Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
USD 620.00
3 Weeks
Lenti ORF clone of Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
USD 121.00
In Stock
PPP1CB HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
USD 396.00
5 Days
Transient overexpression lysate of protein phosphatase 1, catalytic subunit, beta isoform (PPP1CB), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PPP1CB (untagged)-Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 3
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal Protein Phosphatase 1 beta (PPP1CB) Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Protein Phosphatase 1 beta (PPP1CB) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 286-315 amino acids from the C-terminal region of human Protein Phosphatase 1 beta (PPP1CB). |
USD 396.00
5 Days
Transient overexpression lysate of protein phosphatase 1, catalytic subunit, beta isoform (PPP1CB), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-PPP1CB Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP1CB antibody is: synthetic peptide directed towards the C-terminal region of Human PPP1CB. Synthetic peptide located within the following region: LFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRP |
Rabbit Polyclonal Anti-PPP1CB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP1CB antibody is: synthetic peptide directed towards the C-terminal region of Human PPP1CB. Synthetic peptide located within the following region: VPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLI |
USD 121.00
2 Weeks
PPP1CB HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
USD 2,055.00
3 Weeks
PPP1CB MS Standard C13 and N15-labeled recombinant protein (NP_996759)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Anti-PPP1CB Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to N terminal 327 amino acids of human protein phosphatase 1, catalytic subunit, beta isozyme |
Transient overexpression of PPP1CB (NM_206876) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PPP1CB (NM_002709) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PPP1CB (NM_206876) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PPP1CB (NM_206876) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PPP1CB (NM_002709) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PPP1CB (NM_002709) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PPP1CB
Pathways
- Vascular smooth muscle contraction