Germany
Japan
United Kingdom
China
KCNQ1 (Myc-DDK-tagged)-Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
KCNQ1 (Myc-DDK-tagged)-Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
KCNQ1 (GFP-tagged) - Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, KCNQ1 (Myc-DDK tagged) - Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, KCNQ1 (mGFP-tagged) - Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, KCNQ1 (Myc-DDK tagged) - Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, KCNQ1 (mGFP-tagged) - Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
KCNQ1 (GFP-tagged) - Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
KCNQ1 (untagged)-Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, KCNQ1 (Myc-DDK tagged) - Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, KCNQ1 (mGFP-tagged) - Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, KCNQ1 (Myc-DDK tagged) - Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, KCNQ1 (mGFP-tagged) - Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
KCNQ1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human KCNQ1 |
Rabbit Polyclonal Anti-KCNQ1 Antibody
| Applications | IHC, WB |
| Reactivities | Hamster, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ1 antibody: synthetic peptide directed towards the N terminal of human KCNQ1. Synthetic peptide located within the following region: RSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGI |
Lenti ORF clone of Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
KCNQ1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
KCNQ1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
KCNQ1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Purified recombinant protein of Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 2, Ala257-End, with N-terminal His tag, expressed in E.coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
KCNQ1 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 11-42 amino acids from the N-terminal region of human KCNQ1 |
Goat Anti-KCNQ1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EQLTVPRRGPDEGS, from the C-Terminus of the protein sequence according to NP_000209.2; NP_861463.1. |
Rabbit Polyclonal Anti-KV7.1 (KCNQ1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)TYEQLTVPRRGPDEGS, corresponding to amino acid residues 661-676 of human Kv7.1. Intracellular, C-terminus. |
Rabbit Polyclonal Anti-KCNQ1 Antibody
| Applications | WB |
| Reactivities | Hamster, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ1 antibody: synthetic peptide directed towards the N terminal of human KCNQ1. Synthetic peptide located within the following region: IVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGS |
Transient overexpression lysate of potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
LY424853 is the same product as LY424989.
Transient overexpression lysate of potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
KCNQ1 (untagged)-Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of KCNQ1 (NM_181798) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of KCNQ1 (NM_000218) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of KCNQ1 (NM_181798) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of KCNQ1 (NM_181798) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of KCNQ1 (NM_000218) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of KCNQ1 (NM_000218) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- KCNQ1
Pathways
- Vibrio cholerae infection