Products

cDNA Clones (35)
Antibodies (21)
Proteins (16)
Jump to Filters
View as table Download
Caveolin 1 (CAV1) (NM_001753) Human Tagged ORF Clone
RC210274

USD 98.00

USD 390.00

In Stock

CAV1 (Myc-DDK-tagged)-Human caveolin 1, caveolae protein, 22kDa (CAV1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Caveolin 1 (CAV1) (NM_001753) Human Untagged Clone
SC119082

USD 310.00

In Stock

CAV1 (untagged)-Human caveolin 1, caveolae protein, 22kDa (CAV1), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Caveolin 1 (CAV1) (NM_001753) Human Tagged ORF Clone
RG210274

USD 460.00

In Stock

CAV1 (GFP-tagged) - Human caveolin 1, caveolae protein, 22kDa (CAV1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Caveolin 1 (CAV1) (NM_001172895) Human Tagged ORF Clone
RC229589

USD 420.00

In Stock

CAV1 (Myc-DDK-tagged)-Human caveolin 1, caveolae protein, 22kDa (CAV1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Caveolin 1 (CAV1) (NM_001172896) Human Tagged ORF Clone
RC229590

USD 420.00

In Stock

CAV1 (Myc-DDK-tagged)-Human caveolin 1, caveolae protein, 22kDa (CAV1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Caveolin 1 (CAV1) (NM_001172897) Human Tagged ORF Clone
RC229591

USD 420.00

In Stock

CAV1 (Myc-DDK-tagged)-Human caveolin 1, caveolae protein, 22kDa (CAV1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Caveolin 1 (CAV1) (NM_001753) Human Tagged ORF Clone Lentiviral Particle
RC210274L3V

USD 820.00

3 Weeks

Lenti ORF particles, CAV1 (Myc-DDK tagged) - Human caveolin 1, caveolae protein, 22kDa (CAV1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Caveolin 1 (CAV1) (NM_001753) Human Tagged ORF Clone
RC210274L4

USD 620.00

3 Weeks

Lenti ORF clone of Human caveolin 1, caveolae protein, 22kDa (CAV1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Caveolin 1 (CAV1) (NM_001753) Human Tagged ORF Clone Lentiviral Particle
RC210274L4V

USD 820.00

7 Weeks

Lenti ORF particles, CAV1 (mGFP-tagged) - Human caveolin 1, caveolae protein, 22kDa (CAV1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Caveolin 1 (CAV1) (NM_001172895) Human Tagged ORF Clone
RC229589L3

USD 620.00

3 Weeks

Lenti ORF clone of Human caveolin 1, caveolae protein, 22kDa (CAV1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Caveolin 1 (CAV1) (NM_001172895) Human Tagged ORF Clone Lentiviral Particle
RC229589L3V

USD 820.00

7 Weeks

Lenti ORF particles, CAV1 (Myc-DDK tagged) - Human caveolin 1, caveolae protein, 22kDa (CAV1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Caveolin 1 (CAV1) (NM_001172895) Human Tagged ORF Clone
RC229589L4

USD 620.00

3 Weeks

Lenti ORF clone of Human caveolin 1, caveolae protein, 22kDa (CAV1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Caveolin 1 (CAV1) (NM_001172895) Human Tagged ORF Clone Lentiviral Particle
RC229589L4V

USD 820.00

7 Weeks

Lenti ORF particles, CAV1 (mGFP-tagged) - Human caveolin 1, caveolae protein, 22kDa (CAV1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Caveolin 1 (CAV1) (NM_001172896) Human Tagged ORF Clone
RC229590L3

USD 620.00

3 Weeks

Lenti-ORF clone of CAV1 (Myc-DDK-tagged)-Human caveolin 1, caveolae protein, 22kDa (CAV1), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Caveolin 1 (CAV1) (NM_001172896) Human Tagged ORF Clone Lentiviral Particle
RC229590L3V

USD 820.00

6 Weeks

Lenti ORF particles, CAV1 (Myc-DDK-tagged)-Human caveolin 1, caveolae protein, 22kDa (CAV1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Caveolin 1 (CAV1) (NM_001172896) Human Tagged ORF Clone
RC229590L4

USD 620.00

3 Weeks

Lenti-ORF clone of CAV1 (mGFP-tagged)-Human caveolin 1, caveolae protein, 22kDa (CAV1), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Caveolin 1 (CAV1) (NM_001172896) Human Tagged ORF Clone Lentiviral Particle
RC229590L4V

USD 820.00

6 Weeks

Lenti ORF particles, CAV1 (mGFP-tagged)-Human caveolin 1, caveolae protein, 22kDa (CAV1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Caveolin 1 (CAV1) (NM_001172897) Human Tagged ORF Clone
RC229591L3

USD 620.00

3 Weeks

Lenti-ORF clone of CAV1 (Myc-DDK-tagged)-Human caveolin 1, caveolae protein, 22kDa (CAV1), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Caveolin 1 (CAV1) (NM_001172897) Human Tagged ORF Clone Lentiviral Particle
RC229591L3V

USD 820.00

6 Weeks

Lenti ORF particles, CAV1 (Myc-DDK-tagged)-Human caveolin 1, caveolae protein, 22kDa (CAV1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Caveolin 1 (CAV1) (NM_001172897) Human Tagged ORF Clone
RC229591L4

USD 620.00

3 Weeks

Lenti-ORF clone of CAV1 (mGFP-tagged)-Human caveolin 1, caveolae protein, 22kDa (CAV1), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Caveolin 1 (CAV1) (NM_001172897) Human Tagged ORF Clone Lentiviral Particle
RC229591L4V

USD 820.00

6 Weeks

Lenti ORF particles, CAV1 (mGFP-tagged)-Human caveolin 1, caveolae protein, 22kDa (CAV1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Caveolin 1 (CAV1) (NM_001172895) Human Tagged ORF Clone
RG229589

USD 460.00

3 Weeks

CAV1 (GFP-tagged) - Human caveolin 1, caveolae protein, 22kDa (CAV1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Caveolin 1 (CAV1) (NM_001172896) Human Tagged ORF Clone
RG229590

USD 460.00

3 Weeks

CAV1 (GFP-tagged) - Human caveolin 1, caveolae protein, 22kDa (CAV1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Caveolin 1 (CAV1) (NM_001172897) Human Tagged ORF Clone
RG229591

USD 460.00

3 Weeks

CAV1 (GFP-tagged) - Human caveolin 1, caveolae protein, 22kDa (CAV1), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CAV1
AB0055-200

USD 320.00

In Stock

Goat Polyclonal Anti-CAV1 Antibody

Applications IF, WB
Reactivities Canine, Human, Mouse
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 100 aa to the N-terminus of human CAV1 produced in E. coli.
Caveolin 1 (CAV1) (NM_001753) Human Tagged ORF Clone
RC210274L1

USD 768.00

In Stock

Lenti ORF clone of Human caveolin 1, caveolae protein, 22kDa (CAV1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Caveolin 1 (CAV1) (NM_001753) Human Tagged ORF Clone
RC210274L2

USD 620.00

In Stock

Lenti ORF clone of Human caveolin 1, caveolae protein, 22kDa (CAV1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Caveolin 1 (CAV1) Goat Polyclonal Antibody
TA302639

USD 375.00

In Stock

Goat Polyclonal Antibody against Caveolin 1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DELSEKQVYDAH, from the internal region of the protein sequence according to NP_001744.2.
Caveolin 1 (CAV1) (NM_001172895) Human Tagged ORF Clone
RC229589L1

USD 620.00

In Stock

Lenti ORF clone of Human caveolin 1, caveolae protein, 22kDa (CAV1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Caveolin 1 (CAV1) Mouse Monoclonal Antibody [Clone ID: 7C8]
TA301445

USD 479.00

2 Weeks

Mouse Monoclonal Antibody against Caveolin 1 (7C8)

Applications WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Caveolin 1 (CAV1) (1-104) Mouse Monoclonal Antibody [Clone ID: AT4C1]
AM09383PU-N

USD 340.00

2 Weeks

Caveolin 1 (CAV1) (1-104) mouse monoclonal antibody, clone AT4C1, Purified

Applications ELISA, FC, IF, WB
Reactivities Human, Rat
Caveolin 1 (CAV1) (1-104) Mouse Monoclonal Antibody [Clone ID: AT4C1]
AM09383PU-S

USD 230.00

2 Weeks

Caveolin 1 (CAV1) (1-104) mouse monoclonal antibody, clone AT4C1, Purified

Applications ELISA, FC, IF, WB
Reactivities Human, Rat
Caveolin 1 (CAV1) Rabbit Polyclonal Antibody
TA326097

USD 345.00

In Stock

Rabbit polyclonal Caveolin-1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Caveolin-1.
Caveolin 1 (CAV1) Rabbit Polyclonal Antibody
TA347350

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Caveolin-1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Caveolin-1 Antibody: A synthesized peptide derived from human Caveolin-1
Caveolin 1 (CAV1) Rabbit Polyclonal Antibody
TA347996

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Caveolin 1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Caveolin 1 Antibody: A synthesized peptide derived from human Caveolin 1
Caveolin 1 (CAV1) (NM_001172895) Human Tagged ORF Clone
RC229589L2

USD 620.00

3 Weeks

Lenti ORF clone of Human caveolin 1, caveolae protein, 22kDa (CAV1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Caveolin 1 (CAV1) (NM_001172895) Human Untagged Clone
SC328227

USD 420.00

In Stock

CAV1 (untagged)-Human caveolin 1 caveolae protein 22kDa (CAV1) transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Caveolin 1 (CAV1) Rabbit Polyclonal Antibody
TA325301

USD 345.00

In Stock

Rabbit Polyclonal Caveolin-1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Caveolin-1
Caveolin 1 (CAV1) Rabbit Polyclonal Antibody
TA325302

USD 345.00

In Stock

Rabbit Polyclonal Caveolin-1 (Tyr14) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Caveolin-1 around the phosphorylation site of Tyrosine 14
Modifications Phospho-specific
Caveolin 1 (CAV1) (NM_001753) Human Over-expression Lysate
LC400664

USD 121.00

In Stock

CAV1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Caveolin 1 (CAV1) (NM_001172895) Human Over-expression Lysate
LC432589

USD 121.00

In Stock

CAV1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Caveolin 1 (CAV1) Rabbit Polyclonal Antibody
TA330401

USD 310.00

5 Days

Rabbit Polyclonal Anti-CAV1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CAV1 antibody: synthetic peptide directed towards the N terminal of human CAV1. Synthetic peptide located within the following region: MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEID
Caveolin 1 (CAV1) (C-term) Rabbit Polyclonal Antibody
AP31042PU-N

USD 440.00

2 Weeks

Caveolin 1 (CAV1) (C-term) rabbit polyclonal antibody, Purified

Applications IHC
Reactivities Human
Immunogen A synthetic peptide from C-terminal domain of human caveolin-1