Products

cDNA Clones (47)
Proteins (25)
Antibodies (2)
Jump to Filters
View as table Download
PPP2R5C (NM_002719) Human Tagged ORF Clone
RC214000

USD 470.00

In Stock

PPP2R5C (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PPP2R5C (NM_178588) Human Tagged ORF Clone
RC204875

USD 420.00

In Stock

PPP2R5C (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma isoform (PPP2R5C), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PPP2R5C (NM_001161726) Human Tagged ORF Clone
RC228436

USD 500.00

In Stock

PPP2R5C (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PPP2R5C (NM_001161725) Human Tagged ORF Clone
RC228446

USD 500.00

In Stock

PPP2R5C (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PPP2R5C (NM_002719) Human Tagged ORF Clone Lentiviral Particle
RC214000L1V

USD 870.00

3 Weeks

Lenti ORF particles, PPP2R5C (Myc-DDK tagged) - Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PPP2R5C (NM_002719) Human Tagged ORF Clone Lentiviral Particle
RC214000L2V

USD 870.00

6 Weeks

Lenti ORF particles, PPP2R5C (mGFP-tagged) - Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PPP2R5C (NM_002719) Human Tagged ORF Clone
RG214000

USD 520.00

In Stock

PPP2R5C (GFP-tagged) - Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PPP2R5C (NM_178587) Human Tagged ORF Clone
RG217361

USD 460.00

In Stock

PPP2R5C (GFP-tagged) - Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PPP2R5C (NM_178588) Human Tagged ORF Clone
RC204875L3

USD 620.00

3 Weeks

Lenti ORF clone of Human protein phosphatase 2, regulatory subunit B', gamma isoform (PPP2R5C), transcript variant 4, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R5C (NM_178588) Human Tagged ORF Clone Lentiviral Particle
RC204875L3V

USD 820.00

6 Weeks

Lenti ORF particles, PPP2R5C (Myc-DDK tagged) - Human protein phosphatase 2, regulatory subunit B', gamma isoform (PPP2R5C), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R5C (NM_178588) Human Tagged ORF Clone
RC204875L4

USD 620.00

3 Weeks

Lenti ORF clone of Human protein phosphatase 2, regulatory subunit B', gamma isoform (PPP2R5C), transcript variant 4, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R5C (NM_178588) Human Tagged ORF Clone Lentiviral Particle
RC204875L4V

USD 820.00

6 Weeks

Lenti ORF particles, PPP2R5C (mGFP-tagged) - Human protein phosphatase 2, regulatory subunit B', gamma isoform (PPP2R5C), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R5C (NM_178586) Human Tagged ORF Clone
RC211705

USD 450.00

3 Weeks

PPP2R5C (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PPP2R5C (NM_178586) Human Tagged ORF Clone
RC211705L3

USD 650.00

3 Weeks

Lenti-ORF clone of PPP2R5C (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R5C (NM_178586) Human Tagged ORF Clone Lentiviral Particle
RC211705L3V

USD 850.00

6 Weeks

Lenti ORF particles, PPP2R5C (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R5C (NM_178586) Human Tagged ORF Clone
RC211705L4

USD 650.00

3 Weeks

Lenti-ORF clone of PPP2R5C (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R5C (NM_178586) Human Tagged ORF Clone Lentiviral Particle
RC211705L4V

USD 850.00

6 Weeks

Lenti ORF particles, PPP2R5C (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R5C (NM_002719) Human Tagged ORF Clone
RC214000L3

USD 670.00

3 Weeks

Lenti ORF clone of Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R5C (NM_002719) Human Tagged ORF Clone Lentiviral Particle
RC214000L3V

USD 870.00

5 Weeks

Lenti ORF particles, PPP2R5C (Myc-DDK tagged) - Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R5C (NM_002719) Human Tagged ORF Clone
RC214000L4

USD 670.00

3 Weeks

Lenti ORF clone of Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R5C (NM_002719) Human Tagged ORF Clone Lentiviral Particle
RC214000L4V

USD 870.00

7 Weeks

Lenti ORF particles, PPP2R5C (mGFP-tagged) - Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R5C (NM_178587) Human Tagged ORF Clone
RC217361

USD 420.00

3 Weeks

PPP2R5C (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PPP2R5C (NM_178587) Human Tagged ORF Clone
RC217361L3

USD 620.00

3 Weeks

Lenti-ORF clone of PPP2R5C (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R5C (NM_178587) Human Tagged ORF Clone Lentiviral Particle
RC217361L3V

USD 820.00

6 Weeks

Lenti ORF particles, PPP2R5C (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R5C (NM_178587) Human Tagged ORF Clone
RC217361L4

USD 620.00

3 Weeks

Lenti-ORF clone of PPP2R5C (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R5C (NM_178587) Human Tagged ORF Clone Lentiviral Particle
RC217361L4V

USD 820.00

6 Weeks

Lenti ORF particles, PPP2R5C (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R5C (NM_001161726) Human Tagged ORF Clone
RC228436L3

USD 700.00

3 Weeks

Lenti-ORF clone of PPP2R5C (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 6

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R5C (NM_001161726) Human Tagged ORF Clone Lentiviral Particle
RC228436L3V

USD 900.00

6 Weeks

Lenti ORF particles, PPP2R5C (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 6, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R5C (NM_001161726) Human Tagged ORF Clone
RC228436L4

USD 700.00

3 Weeks

Lenti-ORF clone of PPP2R5C (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 6

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R5C (NM_001161726) Human Tagged ORF Clone Lentiviral Particle
RC228436L4V

USD 900.00

6 Weeks

Lenti ORF particles, PPP2R5C (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 6, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R5C (NM_001161725) Human Tagged ORF Clone
RC228446L3

USD 700.00

3 Weeks

Lenti-ORF clone of PPP2R5C (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 5

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R5C (NM_001161725) Human Tagged ORF Clone Lentiviral Particle
RC228446L3V

USD 900.00

6 Weeks

Lenti ORF particles, PPP2R5C (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R5C (NM_001161725) Human Tagged ORF Clone
RC228446L4

USD 700.00

3 Weeks

Lenti-ORF clone of PPP2R5C (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 5

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R5C (NM_001161725) Human Tagged ORF Clone Lentiviral Particle
RC228446L4V

USD 900.00

6 Weeks

Lenti ORF particles, PPP2R5C (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R5C (NM_178588) Human Tagged ORF Clone
RG204875

USD 460.00

3 Weeks

PPP2R5C (GFP-tagged) - Human protein phosphatase 2, regulatory subunit B', gamma isoform (PPP2R5C), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PPP2R5C (NM_178586) Human Tagged ORF Clone
RG211705

USD 500.00

2 Weeks

PPP2R5C (GFP-tagged) - Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PPP2R5C (NM_001161726) Human Tagged ORF Clone
RG228436

USD 550.00

3 Weeks

PPP2R5C (GFP-tagged) - Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PPP2R5C (NM_001161725) Human Tagged ORF Clone
RG228446

USD 550.00

3 Weeks

PPP2R5C (GFP-tagged) - Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PPP2R5C (NM_002719) Human Tagged ORF Clone
RC214000L1

USD 828.00

In Stock

Lenti ORF clone of Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PPP2R5C (NM_178586) Human Untagged Clone
SC101725

USD 820.00

In Stock

PPP2R5C (untagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
SC101725 is the updated version of SC109609.
PPP2R5C Rabbit Polyclonal Antibody
TA344611

USD 475.00

5 Days

Rabbit Polyclonal Anti-PPP2R5C Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP2R5C antibody: synthetic peptide directed towards the middle region of human PPP2R5C. Synthetic peptide located within the following region: RFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGK
PPP2R5C (NM_178588) Human Over-expression Lysate
LY405869

USD 396.00

5 Days

Transient overexpression lysate of protein phosphatase 2, regulatory subunit B', gamma isoform (PPP2R5C), transcript variant 4

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PPP2R5C (NM_002719) Human Tagged ORF Clone
RC214000L2

USD 670.00

3 Weeks

Lenti ORF clone of Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PPP2R5C (NM_001161726) Human Over-expression Lysate
LC431464

USD 121.00

In Stock

PPP2R5C HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PPP2R5C (NM_001161725) Human Over-expression Lysate
LC431474

USD 121.00

In Stock

PPP2R5C HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PPP2R5C (NM_001161726) Human Over-expression Lysate
LY431464

USD 396.00

In Stock

Transient overexpression lysate of protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 6

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PPP2R5C (NM_001161725) Human Over-expression Lysate
LY431474

USD 396.00

In Stock

Transient overexpression lysate of protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 5

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PPP2R5C (NM_002719) Human Untagged Clone
SC109608

USD 890.00

In Stock

PPP2R5C (untagged)-Human protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
PPP2R5C (NM_178588) Human Untagged Clone
SC127990

USD 780.00

In Stock

PPP2R5C (untagged)-Human protein phosphatase 2, regulatory subunit B', gamma isoform (PPP2R5C), transcript variant 4

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PPP2R5C Rabbit Polyclonal Antibody
AP05047PU-N

USD 360.00

5 Days

PPP2R5C rabbit polyclonal antibody, Purified

Applications WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen Antibody raised against synthetic peptide corresponding to amino acids 53 to 66 of the mammalian protein phosphatase 2 A/B conjugated to KLH.