Germany
Japan
United Kingdom
China
GPT2 (Myc-DDK-tagged)-Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
GPT2 (GFP-tagged) - Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GPT2 (Myc-DDK tagged) - Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GPT2 (mGFP-tagged) - Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GPT2 (Myc-DDK-tagged)-Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of GPT2 (Myc-DDK-tagged)-Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GPT2 (Myc-DDK-tagged)-Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of GPT2 (mGFP-tagged)-Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GPT2 (mGFP-tagged)-Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GPT2 (GFP-tagged) - Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Transient overexpression lysate of glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
GPT2 (untagged)-Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal anti-GPT2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPT2 antibody: synthetic peptide directed towards the C terminal of human GPT2. Synthetic peptide located within the following region: PEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVR |
GPT2 (untagged)-Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
GPT2 (1-523, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
| Expression Host | E. coli |
GPT2 (1-523, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
GPT2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
GPT2 MS Standard C13 and N15-labeled recombinant protein (NP_597700)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
GPT2 (untagged)-Human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
Transient overexpression of GPT2 (NM_133443) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GPT2 (NM_001142466) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GPT2 (NM_133443) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GPT2 (NM_133443) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GPT2 (NM_001142466) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- GPT2
Pathways
- aspartate and glutamate metabolism