Products

cDNA Clones (46)
Proteins (33)
Antibodies (4)
Jump to Filters
View as table Download
LYK5 (STRADA) (NM_001003787) Human Tagged ORF Clone
RC221676

USD 420.00

In Stock

STRADA (Myc-DDK-tagged)-Human STE20-related kinase adaptor alpha (STRADA), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
LYK5 (STRADA) (NM_153335) Human Tagged ORF Clone
RC214029

USD 420.00

In Stock

STRADA (Myc-DDK-tagged)-Human STE20-related kinase adaptor alpha (STRADA), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
LYK5 (STRADA) (NM_001003788) Human Tagged ORF Clone
RC215028

USD 98.00

USD 460.00

In Stock

STRADA (Myc-DDK-tagged)-Human STE20-related kinase adaptor alpha (STRADA), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
LYK5 (STRADA) (NM_001165970) Human Tagged ORF Clone
RC228232

USD 420.00

In Stock

STRADA (Myc-DDK-tagged)-Human STE20-related kinase adaptor alpha (STRADA), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
LYK5 (STRADA) (NM_153335) Human Tagged ORF Clone Lentiviral Particle
RC214029L2V

USD 820.00

6 Weeks

Lenti ORF particles, STRADA (mGFP-tagged) - Human STE20-related kinase adaptor alpha (STRADA), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
LYK5 (STRADA) (NM_001003787) Human Tagged ORF Clone
RG221676

USD 460.00

In Stock

STRADA (GFP-tagged) - Human STE20-related kinase adaptor alpha (STRADA), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
LYK5 (STRADA) (NM_001003786) Human Tagged ORF Clone
RC221633

USD 420.00

In Stock

STRADA (Myc-DDK-tagged)-Human STE20-related kinase adaptor alpha (STRADA), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
LYK5 (STRADA) (NM_001165969) Human Tagged ORF Clone
RC228248

USD 420.00

In Stock

STRADA (Myc-DDK-tagged)-Human STE20-related kinase adaptor alpha (STRADA), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
LYK5 (STRADA) (NM_153335) Human Tagged ORF Clone
RG214029

USD 460.00

In Stock

STRADA (GFP-tagged) - Human STE20-related kinase adaptor alpha (STRADA), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
LYK5 (STRADA) (NM_153335) Human Tagged ORF Clone
RC214029L3

USD 620.00

3 Weeks

Lenti ORF clone of Human STE20-related kinase adaptor alpha (STRADA), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LYK5 (STRADA) (NM_153335) Human Tagged ORF Clone Lentiviral Particle
RC214029L3V

USD 820.00

5 Weeks

Lenti ORF particles, STRADA (Myc-DDK tagged) - Human STE20-related kinase adaptor alpha (STRADA), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LYK5 (STRADA) (NM_153335) Human Tagged ORF Clone
RC214029L4

USD 620.00

3 Weeks

Lenti ORF clone of Human STE20-related kinase adaptor alpha (STRADA), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LYK5 (STRADA) (NM_153335) Human Tagged ORF Clone Lentiviral Particle
RC214029L4V

USD 820.00

7 Weeks

Lenti ORF particles, STRADA (mGFP-tagged) - Human STE20-related kinase adaptor alpha (STRADA), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LYK5 (STRADA) (NM_001003788) Human Tagged ORF Clone
RC215028L3

USD 620.00

3 Weeks

Lenti ORF clone of Human STE20-related kinase adaptor alpha (STRADA), transcript variant 4, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LYK5 (STRADA) (NM_001003788) Human Tagged ORF Clone Lentiviral Particle
RC215028L3V

USD 820.00

6 Weeks

Lenti ORF particles, STRADA (Myc-DDK tagged) - Human STE20-related kinase adaptor alpha (STRADA), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LYK5 (STRADA) (NM_001003788) Human Tagged ORF Clone
RC215028L4

USD 620.00

3 Weeks

Lenti ORF clone of Human STE20-related kinase adaptor alpha (STRADA), transcript variant 4, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LYK5 (STRADA) (NM_001003788) Human Tagged ORF Clone Lentiviral Particle
RC215028L4V

USD 820.00

6 Weeks

Lenti ORF particles, STRADA (mGFP-tagged) - Human STE20-related kinase adaptor alpha (STRADA), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LYK5 (STRADA) (NM_001003786) Human Tagged ORF Clone
RC221633L3

USD 620.00

3 Weeks

Lenti-ORF clone of STRADA (Myc-DDK-tagged)-Human STE20-related kinase adaptor alpha (STRADA), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LYK5 (STRADA) (NM_001003786) Human Tagged ORF Clone Lentiviral Particle
RC221633L3V

USD 820.00

6 Weeks

Lenti ORF particles, STRADA (Myc-DDK-tagged)-Human STE20-related kinase adaptor alpha (STRADA), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LYK5 (STRADA) (NM_001003786) Human Tagged ORF Clone
RC221633L4

USD 620.00

3 Weeks

Lenti-ORF clone of STRADA (mGFP-tagged)-Human STE20-related kinase adaptor alpha (STRADA), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LYK5 (STRADA) (NM_001003786) Human Tagged ORF Clone Lentiviral Particle
RC221633L4V

USD 820.00

6 Weeks

Lenti ORF particles, STRADA (mGFP-tagged)-Human STE20-related kinase adaptor alpha (STRADA), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LYK5 (STRADA) (NM_001003787) Human Tagged ORF Clone
RC221676L3

USD 620.00

3 Weeks

Lenti ORF clone of Human STE20-related kinase adaptor alpha (STRADA), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LYK5 (STRADA) (NM_001003787) Human Tagged ORF Clone Lentiviral Particle
RC221676L3V

USD 820.00

6 Weeks

Lenti ORF particles, STRADA (Myc-DDK tagged) - Human STE20-related kinase adaptor alpha (STRADA), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LYK5 (STRADA) (NM_001003787) Human Tagged ORF Clone
RC221676L4

USD 620.00

3 Weeks

Lenti ORF clone of Human STE20-related kinase adaptor alpha (STRADA), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LYK5 (STRADA) (NM_001003787) Human Tagged ORF Clone Lentiviral Particle
RC221676L4V

USD 820.00

6 Weeks

Lenti ORF particles, STRADA (mGFP-tagged) - Human STE20-related kinase adaptor alpha (STRADA), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LYK5 (STRADA) (NM_001165970) Human Tagged ORF Clone
RC228232L3

USD 620.00

3 Weeks

Lenti ORF clone of Human STE20-related kinase adaptor alpha (STRADA), transcript variant 6, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LYK5 (STRADA) (NM_001165970) Human Tagged ORF Clone Lentiviral Particle
RC228232L3V

USD 820.00

6 Weeks

Lenti ORF particles, STRADA (Myc-DDK tagged) - Human STE20-related kinase adaptor alpha (STRADA), transcript variant 6, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LYK5 (STRADA) (NM_001165970) Human Tagged ORF Clone
RC228232L4

USD 620.00

3 Weeks

Lenti ORF clone of Human STE20-related kinase adaptor alpha (STRADA), transcript variant 6, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LYK5 (STRADA) (NM_001165970) Human Tagged ORF Clone Lentiviral Particle
RC228232L4V

USD 820.00

6 Weeks

Lenti ORF particles, STRADA (mGFP-tagged) - Human STE20-related kinase adaptor alpha (STRADA), transcript variant 6, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LYK5 (STRADA) (NM_001165969) Human Tagged ORF Clone
RC228248L3

USD 620.00

3 Weeks

Lenti-ORF clone of STRADA (Myc-DDK-tagged)-Human STE20-related kinase adaptor alpha (STRADA), transcript variant 5

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LYK5 (STRADA) (NM_001165969) Human Tagged ORF Clone Lentiviral Particle
RC228248L3V

USD 820.00

6 Weeks

Lenti ORF particles, STRADA (Myc-DDK-tagged)-Human STE20-related kinase adaptor alpha (STRADA), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LYK5 (STRADA) (NM_001165969) Human Tagged ORF Clone
RC228248L4

USD 620.00

3 Weeks

Lenti-ORF clone of STRADA (mGFP-tagged)-Human STE20-related kinase adaptor alpha (STRADA), transcript variant 5

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LYK5 (STRADA) (NM_001165969) Human Tagged ORF Clone Lentiviral Particle
RC228248L4V

USD 820.00

6 Weeks

Lenti ORF particles, STRADA (mGFP-tagged)-Human STE20-related kinase adaptor alpha (STRADA), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LYK5 (STRADA) (NM_001003788) Human Tagged ORF Clone
RG215028

USD 460.00

3 Weeks

STRADA (GFP-tagged) - Human STE20-related kinase adaptor alpha (STRADA), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
LYK5 (STRADA) (NM_001003786) Human Tagged ORF Clone
RG221633

USD 460.00

3 Weeks

STRADA (GFP-tagged) - Human STE20-related kinase adaptor alpha (STRADA), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
LYK5 (STRADA) (NM_001165970) Human Tagged ORF Clone
RG228232

USD 460.00

3 Weeks

STRADA (GFP-tagged) - Human STE20-related kinase adaptor alpha (STRADA), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
LYK5 (STRADA) (NM_001165969) Human Tagged ORF Clone
RG228248

USD 460.00

3 Weeks

STRADA (GFP-tagged) - Human STE20-related kinase adaptor alpha (STRADA), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
LYK5 (STRADA) Rabbit Polyclonal Antibody
TA347672

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-STRAD Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-STRAD Antibody: A synthesized peptide derived from human STRAD
LYK5 (STRADA) (NM_153335) Human Tagged ORF Clone
RC214029L2

USD 620.00

3 Weeks

Lenti ORF clone of Human STE20-related kinase adaptor alpha (STRADA), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
LYK5 (STRADA) (NM_153335) Human Untagged Clone
SC100826

USD 590.00

In Stock

STRADA (untagged)-Human STE20-related kinase adaptor alpha (STRADA), transcript variant 3

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
LYK5 (STRADA) (NM_153335) Human Recombinant Protein
TP760345

USD 215.00

In Stock

Purified recombinant protein of Homo sapiens STE20-related kinase adaptor alpha (STRADA), transcript variant 3, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
LYK5 (STRADA) (NM_001003788) Human Over-expression Lysate
LY424003

USD 396.00

In Stock

Transient overexpression lysate of STE20-related kinase adaptor alpha (STRADA), transcript variant 4

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LYK5 (STRADA) (NM_001165969) Human Over-expression Lysate
LY431276

USD 396.00

In Stock

Transient overexpression lysate of STE20-related kinase adaptor alpha (STRADA), transcript variant 5

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LYK5 (STRADA) Rabbit Polyclonal Antibody
TA315988

USD 345.00

4 Weeks

Rabbit polyclonal anti-STRAD antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human STRAD.
LYK5 (STRADA) Rabbit Polyclonal Antibody
TA330986

USD 375.00

5 Days

Rabbit polyclonal Anti-LYK5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LYK5 antibody: synthetic peptide directed towards the N terminal of human LYK5. Synthetic peptide located within the following region: MSFLTNDASSESIASFSKQEVMSSFLPEGGCYELLTVIGKGFEDLMTVNL
LYK5 (STRADA) Rabbit Polyclonal Antibody
TA330987

USD 375.00

5 Days

Rabbit polyclonal Anti-LYK5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LYK5 antibody: synthetic peptide directed towards the C terminal of human LYK5. Synthetic peptide located within the following region: AEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFV
STRAD alpha / LYK5 (1-314, His-tag) Human Protein
AR51542PU-N

USD 845.00

2 Weeks

STRAD alpha / LYK5 (1-314, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
STRAD alpha / LYK5 (1-314, His-tag) Human Protein
AR51542PU-S

USD 330.00

2 Weeks

STRAD alpha / LYK5 (1-314, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
LYK5 (STRADA) (NM_153335) Human Over-expression Lysate
LC407054

USD 121.00

2 Weeks

STRADA HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB