Germany
Japan
United Kingdom
China
GADD45A (Myc-DDK-tagged)-Human growth arrest and DNA-damage-inducible, alpha (GADD45A), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
GADD45A (untagged)-Human growth arrest and DNA-damage-inducible, alpha (GADD45A), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF particles, GADD45A (Myc-DDK tagged) - Human growth arrest and DNA-damage-inducible, alpha (GADD45A), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, GADD45A (mGFP-tagged) - Human growth arrest and DNA-damage-inducible, alpha (GADD45A), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Recombinant protein of human growth arrest and DNA-damage-inducible, alpha (GADD45A)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
GADD45A (GFP-tagged) - Human growth arrest and DNA-damage-inducible, alpha (GADD45A), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human growth arrest and DNA-damage-inducible, alpha (GADD45A), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GADD45A (Myc-DDK tagged) - Human growth arrest and DNA-damage-inducible, alpha (GADD45A), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, GADD45A (mGFP-tagged) - Human growth arrest and DNA-damage-inducible, alpha (GADD45A), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GADD45A (Myc-DDK tagged) - Homo sapiens growth arrest and DNA-damage-inducible, alpha (GADD45A), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GADD45A (Myc-DDK tagged) - Homo sapiens growth arrest and DNA-damage-inducible, alpha (GADD45A), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GADD45A (GFP-tagged) - Homo sapiens growth arrest and DNA-damage-inducible, alpha (GADD45A), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GADD45A (GFP-tagged) - Homo sapiens growth arrest and DNA-damage-inducible, alpha (GADD45A), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human growth arrest and DNA-damage-inducible, alpha (GADD45A), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human growth arrest and DNA-damage-inducible, alpha (GADD45A), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of growth arrest and DNA-damage-inducible, alpha (GADD45A)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
GADD45A HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human growth arrest and DNA-damage-inducible, alpha (GADD45A), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
GADD45A (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human GADD45A |
Rabbit Polyclonal Anti-GADD45A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GADD45A antibody: synthetic peptide directed towards the C terminal of human GADD45A. Synthetic peptide located within the following region: LRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPA |
Mouse Monoclonal GADD45a Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GADD45A (1-165, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
GADD45A (1-165, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) GADD45A mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GADD45A mouse monoclonal antibody, clone OTI2B7 (formerly 2B7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
GADD45A MS Standard C13 and N15-labeled recombinant protein (NP_001915)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
GADD45A (untagged) - Homo sapiens growth arrest and DNA-damage-inducible, alpha (GADD45A), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
GADD45A (untagged) - Homo sapiens growth arrest and DNA-damage-inducible, alpha (GADD45A), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
Rabbit Polyclonal Anti-GADD45A Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GADD45A |
GADD45A mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
GADD45A mouse monoclonal antibody, clone OTI1C9 (formerly 1C9), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
GADD45A mouse monoclonal antibody, clone OTI1C9 (formerly 1C9), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
GADD45A mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
GADD45A mouse monoclonal antibody, clone OTI2B7 (formerly 2B7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
GADD45A mouse monoclonal antibody, clone OTI2B7 (formerly 2B7), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
GADD45A mouse monoclonal antibody, clone OTI2B7 (formerly 2B7), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
GADD45A mouse monoclonal antibody, clone OTI2B7 (formerly 2B7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Transient overexpression of GADD45A (NM_001924) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GADD45A (NM_001199742) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GADD45A (NM_001199741) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human growth arrest and DNA-damage-inducible, alpha (GADD45A)
| Tag | N-His |
| Expression Host | E. coli |
Recombinant protein of human growth arrest and DNA-damage-inducible, alpha (GADD45A)
| Tag | N-His |
| Expression Host | E. coli |
Recombinant protein of human growth arrest and DNA-damage-inducible, alpha (GADD45A)
| Tag | N-His |
| Expression Host | E. coli |
Recombinant protein of human growth arrest and DNA-damage-inducible, alpha (GADD45A)
| Tag | N-His |
| Expression Host | E. coli |
Transient overexpression of GADD45A (NM_001924) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GADD45A (NM_001924) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GADD45A (NM_001199742) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GADD45A (NM_001199741) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- GADD45A
Pathways
- p53 signaling pathway