GOT1 (Myc-DDK-tagged)-Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GOT1 (Myc-DDK-tagged)-Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 823.00
In Stock
Recombinant protein of human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 820.00
3 Weeks
Lenti ORF particles, GOT1 (Myc-DDK tagged) - Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, GOT1 (mGFP-tagged) - Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
GOT1 (GFP-tagged) - Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, GOT1 (Myc-DDK tagged) - Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, GOT1 (mGFP-tagged) - Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-GOT1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GOT1 antibody: synthetic peptide directed towards the N terminal of human GOT1. Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV |
GOT1 (untagged)-Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Goat Polyclonal Antibody against GOT1 (Internal region)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RSYRYWDAEKR, from the internal region of the protein sequence according to NP_002070.1. |
Rabbit Polyclonal Anti-GOT1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GOT1 antibody: synthetic peptide directed towards the N terminal of human GOT1. Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV |
Lenti ORF clone of Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
USD 396.00
In Stock
Transient overexpression lysate of glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
GOT1 (untagged)-Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Aspartate Aminotransferase Goat Polyclonal (aa157-167) Antibody
Applications | IHC |
Reactivities | Gibbon, Chimpanzee, Gorilla, Hamster, Human, Orang-Utan, Rat |
Conjugation | Unconjugated |
Immunogen | Aspartate Aminotransferase antibody was raised against synthetic peptide C-RSYRYWDAEKR from an internal region of human GOT1 (NP_002070.1). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Rat, Hamster, Elephant (100%); Marmoset, Goat, Pig, Lizard (91%); Mouse, Panda, Bat, Bovine, Horse, Opossum, Turkey, Chicken, Platypus, Xenopus, Salmon, Pufferfish, Seq squirt (82%). |
Lenti ORF clone of Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
USD 121.00
In Stock
GOT1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Rabbit anti-GOT1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GOT1 |
USD 450.00
2 Weeks
Aspartate Aminotransferase (GOT1) (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human GOT1 |
Goat Polyclonal Antibody against GOT1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-TADFREDPDPRKVN, from the internal region of the protein sequence according to NP_002070.1. |
GOT1 (1-413, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
GOT1 (1-413, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
USD 2,055.00
3 Weeks
GOT1 MS Standard C13 and N15-labeled recombinant protein (NP_002070)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Rabbit Polyclonal Anti-GOT1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GOT1 |
Transient overexpression of GOT1 (NM_002079) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1)
Tag | C-His |
Expression Host | E. coli |
USD 1,900.00
3 Weeks
Recombinant protein of human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1)
Tag | C-His |
Expression Host | E. coli |
USD 760.00
3 Weeks
Recombinant protein of human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1)
Tag | C-His |
Expression Host | E. coli |
USD 2,800.00
3 Weeks
Recombinant protein of human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1)
Tag | C-His |
Expression Host | E. coli |
Transient overexpression of GOT1 (NM_002079) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GOT1 (NM_002079) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack