Rabbit monoclonal antibody against CD13(clone EPR4058)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit monoclonal antibody against CD13(clone EPR4058)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit anti-ANPEP Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ANPEP |
CD13 (dendritic cells, aminopeptidase), rat anti mouse, clone ER-BMDM1
Applications | IHC |
Reactivities | Mouse, Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ANPEP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ANPEP antibody: synthetic peptide directed towards the N terminal of human ANPEP. Synthetic peptide located within the following region: VGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLA |
Mouse Anti-Human CD13 Purified (100 ug)
Applications | FC |
Reactivities | Human |
Conjugation | Unconjugated |
Goat Anti-CD13 / ANPEP (aa79-91) Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-TLKPDSYRVTLRP, from the internal region (near N terminus) of the protein sequence according to NP_001141.2 |
Goat Anti-CD13 / ANPEP Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QLEQFKKDNEET, from the internal region (near C terminus) of the protein sequence according to NP_001141.2 |
Carrier-free (BSA/glycerol-free) ANPEP mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ANPEP mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ANPEP mouse monoclonal antibody, clone OTI3F8 (formerly 3F8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ANPEP Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ANPEP |
CD13 Mouse Monoclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
ANPEP mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ANPEP mouse monoclonal antibody, clone OTI2E4 (formerly 2E4), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
ANPEP mouse monoclonal antibody, clone OTI2E4 (formerly 2E4), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
ANPEP mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ANPEP mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ANPEP mouse monoclonal antibody, clone OTI2F10 (formerly 2F10), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
ANPEP mouse monoclonal antibody, clone OTI2F10 (formerly 2F10), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
ANPEP mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ANPEP mouse monoclonal antibody, clone OTI3F8 (formerly 3F8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ANPEP mouse monoclonal antibody, clone OTI3F8 (formerly 3F8), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
ANPEP mouse monoclonal antibody, clone OTI3F8 (formerly 3F8), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
ANPEP mouse monoclonal antibody, clone OTI3F8 (formerly 3F8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CD13 mouse monoclonal antibody,clone UMAB275
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD13 mouse monoclonal antibody,clone UMAB275
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
CD13 mouse monoclonal antibody,clone UMAB275
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |