Products

Jump to Filters
View as table Download
VDAC2 Rabbit Polyclonal Antibody
TA383211

USD 275.00

3 Weeks

VDAC2 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human VDAC2 (NP_003366.2).
VDAC2 Rabbit Polyclonal Antibody
TA348006

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-VDAC2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-VDAC2 antibody: A synthesized peptide derived from human VDAC2
VDAC2 Rabbit Polyclonal Antibody
TA338534

USD 375.00

5 Days

Rabbit Polyclonal Anti-VDAC2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VDAC2 antibody: synthetic peptide directed towards the N terminal of human VDAC2. Synthetic peptide located within the following region: MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGV
VDAC2 Goat Polyclonal Antibody
TA302629

USD 375.00

5 Days

Goat Polyclonal Antibody against VDAC2 (C Terminus)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-GHKVGLALELEA, from the C Terminus of the protein sequence according to NP_003366.2.
VDAC2 Goat Polyclonal Antibody
TA302698

USD 375.00

5 Days

Goat Polyclonal Antibody against VDAC2 (Internal)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DSAKSKLTRNN, from the internal region of the protein sequence according to NP_003366.2.
VDAC2 Rabbit Polyclonal Antibody
TA336364

USD 424.00

5 Days

Rabbit Polyclonal VDAC2/3 Antibody

Applications WB
Reactivities Human, Bovine, Canine, Feline, Primate
Conjugation Unconjugated
Immunogen Amino acids 120-132 (KKSGKIKSSYKRE) of human VDAC2 protein were used as the immunogen.
VDAC2 Rabbit Polyclonal Antibody
TA338535

USD 375.00

5 Days

Rabbit Polyclonal Anti-VDAC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VDAC2 antibody: synthetic peptide directed towards the N terminal of human VDAC2. Synthetic peptide located within the following region: VKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWN
VDAC2 Rabbit Polyclonal Antibody
TA324028

USD 345.00

4 Weeks

Anti-VDAC2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 283-294 amino acids of human voltage-dependent anion channel 2