Chicken Polyclonal ZGPAT Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | ZGPAT antibody was raised against a 15 amino acid synthetic peptide near the carboxy terminus of human ZGPAT. |
Chicken Polyclonal ZGPAT Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | ZGPAT antibody was raised against a 15 amino acid synthetic peptide near the carboxy terminus of human ZGPAT. |
Rabbit Polyclonal anti-ZGPAT antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ZGPAT antibody: synthetic peptide directed towards the N terminal of human ZGPAT. Synthetic peptide located within the following region: DEESLESALQTYRAQLQQVELALGAGLDSSEQADLRQLQGDLKELIELTE |
Rabbit Polyclonal anti-ZGPAT antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ZGPAT antibody: synthetic peptide directed towards the C terminal of human ZGPAT. Synthetic peptide located within the following region: AGRHSVASAQLQEKLAGAQRQLGQLRAQEAGLQQEQRKADTHKKMTEF |
Rabbit Polyclonal anti-ZGPAT antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ZGPAT antibody: synthetic peptide directed towards the middle region of human ZGPAT. Synthetic peptide located within the following region: LLREAVVEGDGILPPLRTEATESDSDSDGTGDSSYARVVGSDAVDSAQSS |
ZGPAT rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ZGPAT |
ZGPAT rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ZGPAT |