Products

View as table Download

WNT1 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 231-370 of human WNT1 (NP_005421.1).
Modifications Unmodified

WNT1 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 231-370 of human WNT1 (NP_005421.1).
Modifications Unmodified

Rabbit polyclonal anti-WNT1 antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human WNT1.

Rabbit polyclonal anti-Wnt1 antibody

Applications WB
Reactivities Bovine, Human, Macaque, Mouse, Opossum, Rat, Dog
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human Wnt1 protein.

Rabbit Polyclonal Anti-WNT1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT1 antibody: synthetic peptide directed towards the middle region of human WNT1. Synthetic peptide located within the following region: FGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTV

Rabbit Polyclonal Anti-Wnt1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Wnt1 antibody is: synthetic peptide directed towards the C-terminal region of MOUSE Wnt1. Synthetic peptide located within the following region: NFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCN

Rabbit Polyclonal Anti-WNT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human WNT1

WNT1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human WNT1

Wnt1 Rabbit polyclonal Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human WNT1. AA range:301-350