Germany
Japan
United Kingdom
China
WNT1 (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 1 (WNT1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
WNT1 (untagged)-Human wingless-type MMTV integration site family, member 1 (WNT1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
WNT1 (GFP-tagged) - Human wingless-type MMTV integration site family, member 1 (WNT1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Wnt1 (untagged) - Mouse wingless-related MMTV integration site 1 (Wnt1), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF particles, WNT1 (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 1 (WNT1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, WNT1 (mGFP-tagged) - Human wingless-type MMTV integration site family, member 1 (WNT1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Wnt1 (GFP-tagged) - Mouse wingless-related MMTV integration site 1 (cDNA clone MGC:6192 IMAGE:3493095)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Wnt1 (Myc-DDK-tagged) - Mouse wingless-related MMTV integration site 1 (Wnt1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
WNT1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 231-370 of human WNT1 (NP_005421.1). |
| Modifications | Unmodified |
WNT1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 231-370 of human WNT1 (NP_005421.1). |
| Modifications | Unmodified |
WNT1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN410394 is the updated version of KN210394.
Wnt1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN519445 is the updated version of KN319445.
Lenti ORF clone of Wnt1 (Myc-DDK-tagged) - Mouse wingless-related MMTV integration site 1 (Wnt1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Wnt1 (Myc-DDK-tagged) - Mouse wingless-related MMTV integration site 1 (Wnt1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Wnt1 (mGFP-tagged) - Mouse wingless-related MMTV integration site 1 (Wnt1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Wnt1 (GFP-tagged) - Mouse wingless-related MMTV integration site 1 (Wnt1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human wingless-type MMTV integration site family, member 1 (WNT1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, WNT1 (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 1 (WNT1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human wingless-type MMTV integration site family, member 1 (WNT1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, WNT1 (mGFP-tagged) - Human wingless-type MMTV integration site family, member 1 (WNT1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Wnt1 (Myc-DDK-tagged ORF) - Rat wingless-type MMTV integration site family, member 1 (Wnt1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Wnt1 (Myc-DDK-tagged ORF) - Rat wingless-type MMTV integration site family, member 1 (Wnt1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Wnt1 (Myc-DDK-tagged ORF) - Rat wingless-type MMTV integration site family, member 1 (Wnt1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Wnt1 (mGFP-tagged ORF) - Rat wingless-type MMTV integration site family, member 1 (Wnt1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Wnt1 (GFP-tagged ORF) - Rat wingless-type MMTV integration site family, member 1 (Wnt1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Purified recombinant protein of Human wingless-type MMTV integration site family, member 1 (WNT1).
| Tag | Tag Free |
| Expression Host | E. coli |
Transient overexpression lysate of wingless-type MMTV integration site family, member 1 (WNT1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human wingless-type MMTV integration site family, member 1 (WNT1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
WNT1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Wnt1 - Mouse, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 1 (WNT1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal anti-WNT1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human WNT1. |
Wnt1 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Wnt1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
WNT1 (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human WNT1 |
qSTAR qPCR primer pairs against Mus musculus gene Wnt1
Rabbit polyclonal anti-Wnt-1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E. coli expressed human Wnt-1 |
Rabbit polyclonal anti-Wnt1 antibody
| Applications | WB |
| Reactivities | Bovine, Human, Macaque, Mouse, Opossum, Rat, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human Wnt1 protein. |
Mouse monoclonal anti-Wnt1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-Human WNT-1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human WNT-1 |
Rabbit Polyclonal Anti-WNT1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT1 antibody: synthetic peptide directed towards the middle region of human WNT1. Synthetic peptide located within the following region: FGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTV |
Rabbit Polyclonal Anti-Wnt1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Wnt1 antibody is: synthetic peptide directed towards the C-terminal region of MOUSE Wnt1. Synthetic peptide located within the following region: NFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCN |
Rabbit Polyclonal Anti-WNT1 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | WNT1 antibody was raised against synthetic 19 amino acid peptide from internal region of human WNT1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Rat, Elephant, Panda, Bovine, Horse, Rabbit, Pig (100%); Marmoset, Hamster, Chicken, Lizard (95%); Stickleback (84%). |
Rabbit Polyclonal Anti-WNT1 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | WNT1 antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig (100%); Chicken (94%); Lizard (88%); Zebrafish (81%). |
WNT1 CRISPRa kit - CRISPR gene activation of human Wnt family member 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Wnt1 CRISPRa kit - CRISPR gene activation of mouse wingless-type MMTV integration site family, member 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene WNT1
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene WNT1
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
qPCR primer pairs and template standards against Mus musculus gene Wnt1
| Application | Plasmid of exact quantity for transcript copy number calculation |
Wnt1 (untagged ORF) - Rat wingless-type MMTV integration site family, member 1 (Wnt1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Active filters
Target Symbol
- WNT1