Products

cDNA Clones (26)
Primary Antibodies (22)
RNAi (12)
Proteins (8)
Gene Expression (6)
Assay Kits (2)
Jump to Filters
View as table Download
Neuropeptide Y (NPY) (68-97) Rabbit Polyclonal Antibody
AP09564SU-N

USD 600.00

2 Weeks

Neuropeptide Y (NPY) (68-97) rabbit polyclonal antibody, Serum

Applications IF, IHC
Reactivities Human, Rat
Immunogen Synthetic Prepro-NPY 68-97 (C-PON).
Neuropeptide Y (NPY) Rabbit Polyclonal Antibody
TA346234

USD 475.00

5 Days

Rabbit Polyclonal Anti-NPY Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NPY antibody is: synthetic peptide directed towards the middle region of Human NPY. Synthetic peptide located within the following region: CLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSP
Neuropeptide Y (NPY) (31-36) Rabbit Polyclonal Antibody
AP22875PU-N

USD 440.00

2 Weeks

Neuropeptide Y (NPY) (31-36) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC
Reactivities Porcine
Immunogen Synthetic Porcine Neuropeptide Y coupled to bovine thyroglobulin via glutaraldehyde
NPY Rabbit Polyclonal Antibody
TA364161

USD 400.00

2 Weeks

Rabbit polyclonal anti Neuropeptide Y (bo, po); neat antiserum

Applications ELISA
Reactivities Bovine, Porcine
Conjugation Unconjugated
Neuropeptide Y (NPY) Rabbit Polyclonal Antibody
BP162

USD 340.00

5 Days

Neuropeptide Y (NPY) rabbit polyclonal antibody, Serum

Applications IF, IHC
Reactivities Human, Rat
Immunogen Synthetic peptide corresponding to the C-flanking peptide (amino acids 68-97) of Neuropeptide Y.
Neuropeptide Y (NPY) Rabbit Polyclonal Antibody
RA24603-100

USD 360.00

2 Weeks

Neuropeptide Y (NPY) rabbit polyclonal antibody

Applications IF, IHC
Reactivities Chicken, Feline, Guinea Pig, Human, Rat, Zebrafish
Conjugation Unconjugated
Neuropeptide Y (NPY) Rabbit Polyclonal Antibody
AP20664PU-N

USD 370.00

2 Weeks

Neuropeptide Y (NPY) rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat
Neuropeptide Y (NPY) Guinea Pig Polyclonal Antibody
GP14107-150

USD 440.00

2 Weeks

Neuropeptide Y (NPY) guinea pig polyclonal antibody

Applications IHC
Reactivities Rat
Conjugation Unconjugated
Neuropeptide Y (NPY) Rabbit Polyclonal Antibody
TA363924

USD 415.00

2 Weeks

Neuropeptide Y, rabbit anti human/mouse/rat, polyclonal.

Applications ELISA
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala- Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn- Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2
Neuropeptide Y (NPY) Rabbit Polyclonal Antibody
TA363925

USD 710.00

2 Weeks

Neuropeptide Y (NPY), rabbit anti human/mouse/rat, polyclonal.

Applications ELISA
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala- Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn- Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 coupled to carrier protein.
Neuropeptide Y (NPY) Rabbit Polyclonal Antibody
TA363928

USD 690.00

2 Weeks

Neuropeptide Y (NPY), rabbit anti human/mouse/rat/porcine, polyclonal, diluted Antiserum for RIA.

Applications ELISA
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala- Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn- Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 coupled to carrier protein.
NPY Rabbit Polyclonal Antibody
TA364162

USD 690.00

2 Weeks

Rabbit polyclonal anti Neuropeptide Y (bo, po); diluted antiserum

Applications ELISA
Reactivities Bovine, Porcine
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala- Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn- Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 coupled to carrier protein.
NPY Rabbit Polyclonal Antibody
TA364165

USD 655.00

2 Weeks

Rabbit polyclonal anti Neuropeptide Y (bo, po); purified rabbit IgG

Applications ELISA
Reactivities Bovine, Porcine
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala- Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn- Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 coupled to carrier protein.
Neuropeptide Y (NPY) Mouse Monoclonal Antibody [Clone ID: OTI8F8]
CF808282

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) NPY mouse monoclonal antibody, clone OTI8F8 (formerly 8F8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Neuropeptide Y (NPY) Rabbit Polyclonal Antibody
TA321231

USD 345.00

In Stock

Anti-NPY Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
Neuropeptide Y (NPY) Mouse Monoclonal Antibody [Clone ID: OTI8F8]
TA808282S

USD 159.00

2 Days

NPY mouse monoclonal antibody, clone OTI8F8 (formerly 8F8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated