Products

View as table Download

Perilipin-1 (PLIN1) guinea pig polyclonal antibody, Serum

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen Duplicated N-terminus of Perilipin, aa 1-20 (cf. Greenberg et al. 1992, JBC 266, 11341-11346)

Perilipin-1 (PLIN1) mouse monoclonal antibody, clone PERI112.17, Supernatant

Applications IF, IHC, WB
Reactivities Bovine, Human, Mouse, Rat

Rabbit polyclonal anti-Perilipin A antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 510 of mouse Perilipin A.

Perilipin-1 (PLIN1) (488-499) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Monkey
Immunogen Synthetic peptide from internal region of human PLIN

Rabbit Polyclonal Perilipin Antibody

Applications WB
Reactivities Bovine, Human, Mouse, Porcine, Rat, Sheep
Conjugation Unconjugated
Immunogen A synthetic peptide made to a region between residues 450-522 (C-terminus) of the human perilipin protein. [Swiss-Prot# O60240]

Rabbit Polyclonal Anti-PLIN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLIN antibody: synthetic peptide directed towards the N terminal of human PLIN. Synthetic peptide located within the following region: STQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTISTRLRSARNS

Perilipin-1 (PLIN1) (C-term) goat polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Bovine, Canine, Equine, Human, Monkey, Mouse
Immunogen Synthetic peptide from (C-term) of human PLIN

Perilipin-1 (PLIN1) (C-term) guinea pig polyclonal antibody, Serum

Applications IHC, WB
Reactivities Bovine, Human
Immunogen C-terminus of Perilipin-1 (hCTA/B; aa 507-519; cf. Greenberg et al. 1992, JBC 266, 11341-11346)

Goat Polyclonal Antibody against PLIN

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-PREKPKRRVSDS, from the internal region (near the C Terminus) of the protein sequence according to NP_002657.2.

Goat Polyclonal Antibody against PLIN (C-terminal)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EPILGRAQYSQLRKK, from the C Terminus of the protein sequence according to NP_002657.2.

Rabbit Polyclonal Anti-PLIN1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PLIN1

Rabbit Polyclonal Anti-PLIN1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PLIN1

Rabbit Polyclonal Anti-PLIN1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PLIN1